Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 alpha, Mouse (His)

IL-1 alpha protein is an important cytokine found intracellularly in non-hematopoietic cells that bridges innate and adaptive immunity. Binds to IL1R1 and IL1RAP to form a high-affinity receptor complex, initiates signaling through MYD88, IRAK1 or IRAK4, and activates the NF-kappa-B and MAPK pathways. Animal-Free IL-1 alpha Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 alpha protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 alpha Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-alpha-protein-mouse-his.html

Purity

95.00

Smiles

MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS

Molecular Formula

16175 (Gene_ID) P01582 (S115-S270) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actr2 Rat shRNA Lentiviral Particle (Locus ID 289820)
TL701203V 500 µL Each

Actr2 Rat shRNA Lentiviral Particle (Locus ID 289820)

Sign In for Pricing
View Details
C13orf26 sgRNA CRISPR Lentivector (Human) (Target 3)
K0294804 1.0 µg DNA

C13orf26 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CKL1 Polyclonal Antibody
MBS7143590 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CKL1 Polyclonal Antibody

Sign In for Pricing
View Details
Ankyrin Repeat And Death Domain-Containing Protein 1B (ANKDD1B) Antibody
abx030541-01 80 µL

Ankyrin Repeat And Death Domain-Containing Protein 1B (ANKDD1B) Antibody

Sign In for Pricing
View Details
Ankyrin Repeat And Death Domain-Containing Protein 1B (ANKDD1B) Antibody
abx030541-02 400 µL

Ankyrin Repeat And Death Domain-Containing Protein 1B (ANKDD1B) Antibody

Sign In for Pricing
View Details
Thermax encapsulated temperature indicator, + 232 to + 260 °C, pack of 10
1216134 10 PCKS

Thermax encapsulated temperature indicator, + 232 to + 260 °C, pack of 10

Sign In for Pricing
View Details