Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 alpha, Mouse (His)

IL-1 alpha protein is an important cytokine found intracellularly in non-hematopoietic cells that bridges innate and adaptive immunity. Binds to IL1R1 and IL1RAP to form a high-affinity receptor complex, initiates signaling through MYD88, IRAK1 or IRAK4, and activates the NF-kappa-B and MAPK pathways. Animal-Free IL-1 alpha Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 alpha protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 alpha Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-alpha-protein-mouse-his.html

Purity

95.00

Smiles

MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS

Molecular Formula

16175 (Gene_ID) P01582 (S115-S270) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal HIF-2 alpha/EPAS1 Antibody [Allophycocyanin/Cy7]
NB100-122APCCY7 0.1 mL

Rabbit Polyclonal HIF-2 alpha/EPAS1 Antibody [Allophycocyanin/Cy7]

Sign In for Pricing
View Details
N-Benzyl Salbutamol Acetonide
165337 25 mg

N-Benzyl Salbutamol Acetonide

Sign In for Pricing
View Details
WWC1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
50480061 1.0 µg DNA

WWC1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CD137 (TNFRSF9) Mouse Monoclonal Antibody [Clone ID: OTI7B6]
TA813095S 30 µL

CD137 (TNFRSF9) Mouse Monoclonal Antibody [Clone ID: OTI7B6]

Sign In for Pricing
View Details
PKD1P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV772854 1.0 µg DNA

PKD1P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Stem Cell Factor (Kitlg, Mgf, Sl, Slf, SCF)
215142 100 µg

Stem Cell Factor (Kitlg, Mgf, Sl, Slf, SCF)

Sign In for Pricing
View Details