Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 alpha, Mouse (His)

IL-1 alpha protein is an important cytokine found intracellularly in non-hematopoietic cells that bridges innate and adaptive immunity. Binds to IL1R1 and IL1RAP to form a high-affinity receptor complex, initiates signaling through MYD88, IRAK1 or IRAK4, and activates the NF-kappa-B and MAPK pathways. Animal-Free IL-1 alpha Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 alpha protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 alpha Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-alpha-protein-mouse-his.html

Purity

95.00

Smiles

MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS

Molecular Formula

16175 (Gene_ID) P01582 (S115-S270) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HMG20B Pre-designed siRNA Set A
SI007120A 1 Each

Human HMG20B Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lentiviral human FSD1L shRNA (UAS) - Lentiviral human FSD1L shRNA (UAS, RFP) (25)
GTR15329918 1 Vial

Lentiviral human FSD1L shRNA (UAS) - Lentiviral human FSD1L shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Anti-DNA-PKcs Mouse mAb
MBS475013-01 0.1 mL

Anti-DNA-PKcs Mouse mAb

Sign In for Pricing
View Details
Anti-DNA-PKcs Mouse mAb
MBS475013-02 5x 0.1 mL

Anti-DNA-PKcs Mouse mAb

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 8 (petN), partial
MBS1068695-01 1 mg (E-Coli)

Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 8 (petN), partial

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 8 (petN), partial
MBS1068695-02 1 mg (Yeast)

Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 8 (petN), partial

Sign In for Pricing
View Details