Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 alpha, Mouse (His)

IL-1 alpha protein is an important cytokine found intracellularly in non-hematopoietic cells that bridges innate and adaptive immunity. Binds to IL1R1 and IL1RAP to form a high-affinity receptor complex, initiates signaling through MYD88, IRAK1 or IRAK4, and activates the NF-kappa-B and MAPK pathways. Animal-Free IL-1 alpha Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 alpha protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 alpha Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-alpha-protein-mouse-his.html

Purity

95.00

Smiles

MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS

Molecular Formula

16175 (Gene_ID) P01582 (S115-S270) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FUCA1 (Alpha-L-fucosidase 1, Alpha-L-fucosidase I, Alpha-L-fucoside Fucohydrolase 1, FUCA, Nbla10230, Tissue alpha-L-fucosidase) (PE) discontinued
F9165-50B-PE 200 µL

FUCA1 (Alpha-L-fucosidase 1, Alpha-L-fucosidase I, Alpha-L-fucoside Fucohydrolase 1, FUCA, Nbla10230, Tissue alpha-L-fucosidase) (PE) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal NICE-3 Antibody [DyLight 594]
NBP2-97389DL594 0.1 mL

Rabbit Polyclonal NICE-3 Antibody [DyLight 594]

Sign In for Pricing
View Details
RGD1309735 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6624706 1.0 µg DNA

RGD1309735 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
C14orf182 siRNA (Human)
MBS8218903-01 15 nmol

C14orf182 siRNA (Human)

Sign In for Pricing
View Details
C14orf182 siRNA (Human)
MBS8218903-02 30 nmol

C14orf182 siRNA (Human)

Sign In for Pricing
View Details
C14orf182 siRNA (Human)
MBS8218903-03 5x 30 nmol

C14orf182 siRNA (Human)

Sign In for Pricing
View Details