Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 alpha, Mouse (His)

IL-1 alpha protein is an important cytokine found intracellularly in non-hematopoietic cells that bridges innate and adaptive immunity. Binds to IL1R1 and IL1RAP to form a high-affinity receptor complex, initiates signaling through MYD88, IRAK1 or IRAK4, and activates the NF-kappa-B and MAPK pathways. Animal-Free IL-1 alpha Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 alpha protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 alpha Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-alpha-protein-mouse-his.html

Purity

95.00

Smiles

MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS

Molecular Formula

16175 (Gene_ID) P01582 (S115-S270) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trace Amine-Associated Receptor 2 (TAAR2) Antibody
abx376190 100 µg

Trace Amine-Associated Receptor 2 (TAAR2) Antibody

Sign In for Pricing
View Details
MKRNP3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1306305 3x 1.0 µg

MKRNP3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
pCMV-SPORT6-ZNF585A Plasmid
PVT22857 2 µg

pCMV-SPORT6-ZNF585A Plasmid

Sign In for Pricing
View Details
PCDHA3 (NM_031497) Human Tagged ORF Clone Lentiviral Particle
RC221854L3V 200 µL

PCDHA3 (NM_031497) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-Aquaporin 1 antibody
MBS175198-01 0.01 mg

Anti-Aquaporin 1 antibody

Sign In for Pricing
View Details
Anti-Aquaporin 1 antibody
MBS175198-02 0.1 mg (Carrier Free)

Anti-Aquaporin 1 antibody

Sign In for Pricing
View Details