Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 alpha, Mouse (His)

IL-1 alpha protein is an important cytokine found intracellularly in non-hematopoietic cells that bridges innate and adaptive immunity. Binds to IL1R1 and IL1RAP to form a high-affinity receptor complex, initiates signaling through MYD88, IRAK1 or IRAK4, and activates the NF-kappa-B and MAPK pathways. Animal-Free IL-1 alpha Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 alpha protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 alpha Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-alpha-protein-mouse-his.html

Purity

95.00

Smiles

MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS

Molecular Formula

16175 (Gene_ID) P01582 (S115-S270) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PBS 1X with NP-40
40120357-2 500 mL

PBS 1X with NP-40

Sign In for Pricing
View Details
ZNF566 (NM_032838) Human Untagged Clone
SC102058 10 µg

ZNF566 (NM_032838) Human Untagged Clone

Sign In for Pricing
View Details
SLC12A1 Protein Vector (Rat) (pPM-C-His)
PV305197 500 ng

SLC12A1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
ACAT1 (BC010942) Human Untagged Clone
SC105810 10 µg

ACAT1 (BC010942) Human Untagged Clone

Sign In for Pricing
View Details
Lipin 2 (Lipin-2, LPIN2, KIAA0249, Phosphatidate Phosphatase LPIN2) (MaxLight 405)
MBS6485174-01 0.1 mL

Lipin 2 (Lipin-2, LPIN2, KIAA0249, Phosphatidate Phosphatase LPIN2) (MaxLight 405)

Sign In for Pricing
View Details
Lipin 2 (Lipin-2, LPIN2, KIAA0249, Phosphatidate Phosphatase LPIN2) (MaxLight 405)
MBS6485174-02 5x 0.1 mL

Lipin 2 (Lipin-2, LPIN2, KIAA0249, Phosphatidate Phosphatase LPIN2) (MaxLight 405)

Sign In for Pricing
View Details