Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 alpha, Mouse (His)

IL-1 alpha protein is an important cytokine found intracellularly in non-hematopoietic cells that bridges innate and adaptive immunity. Binds to IL1R1 and IL1RAP to form a high-affinity receptor complex, initiates signaling through MYD88, IRAK1 or IRAK4, and activates the NF-kappa-B and MAPK pathways. Animal-Free IL-1 alpha Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 alpha protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 alpha Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-alpha-protein-mouse-his.html

Purity

95.00

Smiles

MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS

Molecular Formula

16175 (Gene_ID) P01582 (S115-S270) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Galectin-1 Antibody (GAL1/1831) [Alexa Fluor 647]
NBP2-54457AF647 100 µL

Mouse Monoclonal Galectin-1 Antibody (GAL1/1831) [Alexa Fluor 647]

Sign In for Pricing
View Details
PCDHB5 Protein Vector (Mouse) (pPM-C-His)
PV214093 500 ng

PCDHB5 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
CWC27 Antibody (C-term) [APR32810G]
APR32810G-01 50 µL

CWC27 Antibody (C-term) [APR32810G]

Sign In for Pricing
View Details
CWC27 Antibody (C-term) [APR32810G]
APR32810G-02 100 µL

CWC27 Antibody (C-term) [APR32810G]

Sign In for Pricing
View Details
CWC27 Antibody (C-term) [APR32810G]
APR32810G-03 200 µL

CWC27 Antibody (C-term) [APR32810G]

Sign In for Pricing
View Details
CWC27 Antibody (C-term) [APR32810G]
APR32810G-04 400 µL

CWC27 Antibody (C-term) [APR32810G]

Sign In for Pricing
View Details