Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 alpha, Mouse (His)

IL-1 alpha protein is an important cytokine found intracellularly in non-hematopoietic cells that bridges innate and adaptive immunity. Binds to IL1R1 and IL1RAP to form a high-affinity receptor complex, initiates signaling through MYD88, IRAK1 or IRAK4, and activates the NF-kappa-B and MAPK pathways. Animal-Free IL-1 alpha Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 alpha protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 alpha Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-alpha-protein-mouse-his.html

Purity

95.00

Smiles

MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS

Molecular Formula

16175 (Gene_ID) P01582 (S115-S270) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HGFA Polyclonal Antibody, Biotin Conjugated
bs-9913R-Biotin 100 µL

HGFA Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
TMTC2 Recombinant Protein Antigen
NBP1-85027PEP 0.1 mL

TMTC2 Recombinant Protein Antigen

Sign In for Pricing
View Details
Chl1 sgRNA CRISPR Lentivector set (Mouse)
K3780001 3x 1.0 µg

Chl1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Smcp sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3402608 1.0 µg DNA

Smcp sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Lentiviral mouse Zp2 shRNA (UAS) - Lentiviral mouse Zp2 shRNA (UAS, iRFP) (25)
GTR15221378 1 Vial

Lentiviral mouse Zp2 shRNA (UAS) - Lentiviral mouse Zp2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Bzw1 (BC005466) Mouse Tagged ORF Clone
MR206643 10 µg

Bzw1 (BC005466) Mouse Tagged ORF Clone

Sign In for Pricing
View Details