Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 alpha, Mouse (His)

IL-1 alpha protein is an important cytokine found intracellularly in non-hematopoietic cells that bridges innate and adaptive immunity. Binds to IL1R1 and IL1RAP to form a high-affinity receptor complex, initiates signaling through MYD88, IRAK1 or IRAK4, and activates the NF-kappa-B and MAPK pathways. Animal-Free IL-1 alpha Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 alpha protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 alpha Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-alpha-protein-mouse-his.html

Purity

95.00

Smiles

MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS

Molecular Formula

16175 (Gene_ID) P01582 (S115-S270) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Ig gamma-4 Chain C Region Antibody (IGHG4/1345) [DyLight 488]
NBP2-54461G 0.1 mL

Mouse Monoclonal Ig gamma-4 Chain C Region Antibody (IGHG4/1345) [DyLight 488]

Sign In for Pricing
View Details
Ulex europaeus Lectin (UEA I) - Separopore® 4B
20120004-2 10 mL

Ulex europaeus Lectin (UEA I) - Separopore® 4B

Sign In for Pricing
View Details
Sdsl 3'UTR Luciferase Stable Cell Line
TU220044 1.0 mL

Sdsl 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GBP5 Mouse Monoclonal Antibody [Clone ID: LBI8B12]
AMM10773V 100 µL

GBP5 Mouse Monoclonal Antibody [Clone ID: LBI8B12]

Sign In for Pricing
View Details
HTATSF1 (HIV-1 Tat Specific Factor 1, TATSF1, TAT-SF1, dJ196E23.2) (MaxLight 750)
MBS6421797-01 0.1 mL

HTATSF1 (HIV-1 Tat Specific Factor 1, TATSF1, TAT-SF1, dJ196E23.2) (MaxLight 750)

Sign In for Pricing
View Details
HTATSF1 (HIV-1 Tat Specific Factor 1, TATSF1, TAT-SF1, dJ196E23.2) (MaxLight 750)
MBS6421797-02 5x 0.1 mL

HTATSF1 (HIV-1 Tat Specific Factor 1, TATSF1, TAT-SF1, dJ196E23.2) (MaxLight 750)

Sign In for Pricing
View Details