Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 alpha, Mouse (His)

IL-1 alpha protein is an important cytokine found intracellularly in non-hematopoietic cells that bridges innate and adaptive immunity. Binds to IL1R1 and IL1RAP to form a high-affinity receptor complex, initiates signaling through MYD88, IRAK1 or IRAK4, and activates the NF-kappa-B and MAPK pathways. Animal-Free IL-1 alpha Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 alpha protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 alpha Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-alpha-protein-mouse-his.html

Purity

95.00

Smiles

MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS

Molecular Formula

16175 (Gene_ID) P01582 (S115-S270) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal HSD11B1L Antibody
NBP2-55319 100 µL

Rabbit Polyclonal HSD11B1L Antibody

Sign In for Pricing
View Details
IRAK inhibitor 6 (IRAK-IN-6) 25mg
A11460-25 25 mg

IRAK inhibitor 6 (IRAK-IN-6) 25mg

Sign In for Pricing
View Details
Anti-Cleaved Caspase-7 Rabbit pAb
GB115728-50 50 μL

Anti-Cleaved Caspase-7 Rabbit pAb

Sign In for Pricing
View Details
Polyclonal Anti-ROCK2 Antibody
GWB-BBP173 0.1 mg

Polyclonal Anti-ROCK2 Antibody

Sign In for Pricing
View Details
Aldolase A (h) -PR
sc-29664-PR 10 µM - 20 µL

Aldolase A (h) -PR

Sign In for Pricing
View Details
Prolactin Receptor, Intermediate isoform (PRLR, PRL-R, PRL Receptor) (MaxLight 650)
MBS6494663-01 0.1 mL

Prolactin Receptor, Intermediate isoform (PRLR, PRL-R, PRL Receptor) (MaxLight 650)

Sign In for Pricing
View Details