Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 alpha, Mouse (His)

IL-1 alpha protein is an important cytokine found intracellularly in non-hematopoietic cells that bridges innate and adaptive immunity. Binds to IL1R1 and IL1RAP to form a high-affinity receptor complex, initiates signaling through MYD88, IRAK1 or IRAK4, and activates the NF-kappa-B and MAPK pathways. Animal-Free IL-1 alpha Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 alpha protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 alpha Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-alpha-protein-mouse-his.html

Purity

95.00

Smiles

MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS

Molecular Formula

16175 (Gene_ID) P01582 (S115-S270) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TAG-72 Antibody (CC49) [DyLight 550]
NBP2-33128R 0.1 mL

Mouse Monoclonal TAG-72 Antibody (CC49) [DyLight 550]

Sign In for Pricing
View Details
Mouse Grtp1 Pre-designed siRNA Set B
SI105893B 1 Each

Mouse Grtp1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Priliximab Biosimilar - Research Grade
ICH5788-25mg 25 mg

Priliximab Biosimilar - Research Grade

Sign In for Pricing
View Details
ZNF107 (NM_016220) Human Tagged ORF Clone Lentiviral Particle
RC207897L3V 200 µL

ZNF107 (NM_016220) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
POU5F1P3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1691506 1.0 µg DNA

POU5F1P3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Rabbit Monoclonal Elastin Antibody (ELN/3131R) [Alexa Fluor 532]
NBP3-08890AF532 100 µL

Rabbit Monoclonal Elastin Antibody (ELN/3131R) [Alexa Fluor 532]

Sign In for Pricing
View Details