Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-1 alpha, Mouse (His)

IL-1 alpha protein is an important cytokine found intracellularly in non-hematopoietic cells that bridges innate and adaptive immunity. Binds to IL1R1 and IL1RAP to form a high-affinity receptor complex, initiates signaling through MYD88, IRAK1 or IRAK4, and activates the NF-kappa-B and MAPK pathways. Animal-Free IL-1 alpha Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-1 alpha protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-1 alpha Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-1-alpha-protein-mouse-his.html

Purity

95.00

Smiles

MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS

Molecular Formula

16175 (Gene_ID) P01582 (S115-S270) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASK Antibody (Center K227)
MBS9217136-01 0.08 mL

CASK Antibody (Center K227)

Sign In for Pricing
View Details
CASK Antibody (Center K227)
MBS9217136-02 0.4 mL

CASK Antibody (Center K227)

Sign In for Pricing
View Details
CASK Antibody (Center K227)
MBS9217136-03 5x 0.4 mL

CASK Antibody (Center K227)

Sign In for Pricing
View Details
Activating Transcription Factor 7-interacting protein 2 (ATF7IP2) Mouse ELISA Kit
B2441 96 Tests

Activating Transcription Factor 7-interacting protein 2 (ATF7IP2) Mouse ELISA Kit

Sign In for Pricing
View Details
C6 Ceramide-d11
HY-19542S1 1 mg

C6 Ceramide-d11

Sign In for Pricing
View Details
Chicken Semaphorin 6B (SEMA6B) ELISA Kit
MBS9388578 Inquire

Chicken Semaphorin 6B (SEMA6B) ELISA Kit

Sign In for Pricing
View Details