Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMP IL-12, Human (HEK293)

Interleukin-12 subunit alpha (IL-12A; IL-12p35), an immune-suppressive cytokine, encodes a subunit of the cytokine IL-12 that acts on T and natural killer cells, and has a broad array of biological activities. IL-12A heterodimerizes with IL-12B to form the IL-12 cytokine or with EBI3/IL27B to form the IL-35 cytokine[1][2]. GMP IL-12 Protein, Human (HEK293), a recombinant GMP-grade protein, is produced in HEK293 cells. It consists of IL-12A and IL-12B.

Product Specifications

Product Name Alternative

GMP IL-12 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmp-il-12-protein-human-hek293.html

Purity

95.0

Smiles

RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS&:IWELKKDVYVVELDWYPDAPGEMVVLTCDTPE

Molecular Formula

3592&3593 (Gene_ID) P29459 (R23-S219) &P29460 (I23-S328) (Accession)

Molecular Weight

25-38&40-50 kDa

References & Citations

[1]Ivy M Dambuza, et al. IL-12p35 induces expansion of IL-10 and IL-35-expressing regulatory B cells and ameliorates autoimmune disease. Nat Commun. 2017 Sep 28;8 (1) :719.|[2]Jin Kyeong Choi, et al. IL-12p35 Inhibits Neuroinflammation and Ameliorates Autoimmune Encephalomyelitis. Front Immunol. 2017 Oct 5;8:1258.|[3]D De Wit, et al. Helper T-cell responses elicited by Der p 1-pulsed dendritic cells and recombinant IL-12 in atopic and healthy subjects. J Allergy Clin Immunol. 2000 Feb;105 (2 Pt 1) :346-52.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Heat Shock Protein 90kDa Alpha A1 (HSP90aA1) ELISA Kit
DL-HSP90aA1-b-01 48 Tests

Bovine Heat Shock Protein 90kDa Alpha A1 (HSP90aA1) ELISA Kit

Sign In for Pricing
View Details
Bovine Heat Shock Protein 90kDa Alpha A1 (HSP90aA1) ELISA Kit
DL-HSP90aA1-b-02 96 Tests

Bovine Heat Shock Protein 90kDa Alpha A1 (HSP90aA1) ELISA Kit

Sign In for Pricing
View Details
Desmoglein-1 (DSG1) (DSG1/1733), CF488A conjugate, 0.1mg/mL
BNC881733-500 1x 500 µL

Desmoglein-1 (DSG1) (DSG1/1733), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-Thrombomodulin / CD141 Rabbit Monoclonal Antibody
M01325-2 100 µL/Vial

Anti-Thrombomodulin / CD141 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
WDHD1 (NM_007086) Human Tagged Lenti ORF Clone
RC216745L4 10 µg

WDHD1 (NM_007086) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TRNAV22 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2530207 1.0 µg DNA

TRNAV22 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details