CD3D, Canine (HEK293, Fc)
CD3D protein is a component of the TCR-CD3 complex on T lymphocytes and plays a key role in adaptive immunity. It transmits signals through the CD3D, CD3E, CD3G, and CD3Z chains upon TCR engagement. CD3D Protein, Canine (HEK293, Fc) is the recombinant canine-derived CD3D protein, expressed by HEK293 , with C-hFc labeled tag.
Product Specifications
Product Name Alternative
CD3D Protein, Canine (HEK293, Fc), Canine, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd3d-protein-canine-hek293-fc.html
Purity
96.00
Smiles
FKVSVEELEDRVFLSCNTSVLRIEGTMGIQLPHSRTLDLGKRILDPRGIYRCNATEEQSDKAPYMQVYYRMCQNCVELNSAT
Molecular Formula
479419 (Gene_ID) A0A8C0PNZ1/XP_536556 (F22-T103) (Accession)
Molecular Weight
Approximately 43-50 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Human sVCAM-1/CD106(soluble Vascular Cell Adhesion Molecule 1) ELISA Kit
Human sVCAM-1/CD106(soluble Vascular Cell Adhesion Molecule 1) ELISA Kit
Recombinant Oryza sativa subsp. indica Oxygen-evolving enhancer protein 3, chloroplastic (OsI_025465)
Recombinant Oryza sativa subsp. indica Oxygen-evolving enhancer protein 3, chloroplastic (OsI_025465)
Recombinant Oryza sativa subsp. indica Oxygen-evolving enhancer protein 3, chloroplastic (OsI_025465)