What is the catalog number for Recombinant Human Caspase-7 (CASP7), partial?

The catalog number for Recombinant Human Caspase-7 (CASP7), partial is CSB-EP004552HU.

What sizes are available for Recombinant Human Caspase-7 (CASP7), partial?

Recombinant Human Caspase-7 (CASP7), partial is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Human Caspase-7 (CASP7), partial come in?

Recombinant Human Caspase-7 (CASP7), partial is available in 3 different pack sizes.

Is Recombinant Human Caspase-7 (CASP7), partial in stock?

Recombinant Human Caspase-7 (CASP7), partial is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures Recombinant Human Caspase-7 (CASP7), partial?

Recombinant Human Caspase-7 (CASP7), partial is manufactured by Cusabio.

What is the estimated delivery time for Recombinant Human Caspase-7 (CASP7), partial?

Estimated delivery time for Recombinant Human Caspase-7 (CASP7), partial is approximately 15 business day(s), depending on your location.

Where can I find the safety data sheet (SDS/MSDS) for Recombinant Human Caspase-7 (CASP7), partial?

The safety data sheet for Recombinant Human Caspase-7 (CASP7), partial is available here: https://www.cusabio.com/msds/12550064/.

Recombinant Human Caspase-7 (CASP7), partial

Product Specifications

Product Name Alternative

Apoptotic protease Mch-3CMH-1ICE-like apoptotic protease 3 ; ICE-LAP3

Abbreviation

Recombinant Human CASP7 protein, partial

Gene Name

CASP7

UniProt

P55210

Expression Region

207-303aa

Organism

Homo sapiens (Human)

Target Sequence

ANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Apoptosis

Relevance

Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves and activates sterol regulatory elent binding proteins (SREBPs) . Proteolytically cleaves poly (ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Overexpression promotes programmed cell death.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves and activates sterol regulatory element binding proteins (SREBPs) . Proteolytically cleaves poly (ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Overexpression promotes programmed cell death.

Molecular Weight

15.3 kDa

References & Citations

Mch3, a novel human apoptotic cysteine protease highly related to CPP32.Fernandes-Alnemri T., Takahashi A., Armstrong R.C., Krebs J., Fritz L.C., Tomaselli K.J., Wang L., Yu Z., Croce C.M., Salveson G., Earnshaw W.C., Litwack G., Alnemri E.S.Cancer Res. 55:6045-6052 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.