Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GYPA/CD235a, Human (GST)

GYPA, also known as glycoprotein A, is a major membrane protein in red blood cells and plays an important role in the integrity of cell membranes. GYPA is a receptor for influenza virus, Plasmodium falciparum erythrocyte binding Antigen 175 (EBA-175), and hepatitis A virus (HAV) . GYPA/CD235a Protein, Human (GST) is the recombinant human-derived GYPA/CD235a protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

GYPA/CD235a Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gypa-cd235a-protein-human-gst.html

Smiles

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Molecular Formula

2993 (Gene_ID) A0A0C4DFT7 (L20-E91) (Accession)

Molecular Weight

Approximately 34.9 kDa

References & Citations

[1]Suwanwootichai P, et al. Fatal haemolytic transfusion reaction due to anti-Ena and identification of a novel GYPA c.295delG variant in a Thai family. Vox Sang. 2022 Nov;117 (11) :1327-1331.|[2]Bigham AW, et al. Complex signatures of natural selection at GYPA. Hum Genet. 2018 Feb;137 (2) :151-160.|[3]Suades R, et al. Growing thrombi release increased levels of CD235a (+) microparticles and decreased levels of activated platelet-derived microparticles. Validation in ST-elevation myocardial infarction patients. J Thromb Haemost. 2015 Oct;13 (10) :1776-86.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Coccidioides posadasii 4-hydroxyphenylpyruvate dioxygenase (TCRP)
MBS1014649-01 0.02 mg (E-Coli)

Recombinant Coccidioides posadasii 4-hydroxyphenylpyruvate dioxygenase (TCRP)

Sign In for Pricing
View Details
Recombinant Coccidioides posadasii 4-hydroxyphenylpyruvate dioxygenase (TCRP)
MBS1014649-02 0.02 mg (Yeast)

Recombinant Coccidioides posadasii 4-hydroxyphenylpyruvate dioxygenase (TCRP)

Sign In for Pricing
View Details
Recombinant Coccidioides posadasii 4-hydroxyphenylpyruvate dioxygenase (TCRP)
MBS1014649-03 0.1 mg (E-Coli)

Recombinant Coccidioides posadasii 4-hydroxyphenylpyruvate dioxygenase (TCRP)

Sign In for Pricing
View Details
Recombinant Coccidioides posadasii 4-hydroxyphenylpyruvate dioxygenase (TCRP)
MBS1014649-04 0.1 mg (Yeast)

Recombinant Coccidioides posadasii 4-hydroxyphenylpyruvate dioxygenase (TCRP)

Sign In for Pricing
View Details
Recombinant Coccidioides posadasii 4-hydroxyphenylpyruvate dioxygenase (TCRP)
MBS1014649-05 0.02 mg (Baculovirus)

Recombinant Coccidioides posadasii 4-hydroxyphenylpyruvate dioxygenase (TCRP)

Sign In for Pricing
View Details
Recombinant Coccidioides posadasii 4-hydroxyphenylpyruvate dioxygenase (TCRP)
MBS1014649-06 0.02 mg (Mammalian-Cell)

Recombinant Coccidioides posadasii 4-hydroxyphenylpyruvate dioxygenase (TCRP)

Sign In for Pricing
View Details