Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GYPA/CD235a, Human (GST)

GYPA, also known as glycoprotein A, is a major membrane protein in red blood cells and plays an important role in the integrity of cell membranes. GYPA is a receptor for influenza virus, Plasmodium falciparum erythrocyte binding Antigen 175 (EBA-175), and hepatitis A virus (HAV) . GYPA/CD235a Protein, Human (GST) is the recombinant human-derived GYPA/CD235a protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

GYPA/CD235a Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gypa-cd235a-protein-human-gst.html

Smiles

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Molecular Formula

2993 (Gene_ID) A0A0C4DFT7 (L20-E91) (Accession)

Molecular Weight

Approximately 34.9 kDa

References & Citations

[1]Suwanwootichai P, et al. Fatal haemolytic transfusion reaction due to anti-Ena and identification of a novel GYPA c.295delG variant in a Thai family. Vox Sang. 2022 Nov;117 (11) :1327-1331.|[2]Bigham AW, et al. Complex signatures of natural selection at GYPA. Hum Genet. 2018 Feb;137 (2) :151-160.|[3]Suades R, et al. Growing thrombi release increased levels of CD235a (+) microparticles and decreased levels of activated platelet-derived microparticles. Validation in ST-elevation myocardial infarction patients. J Thromb Haemost. 2015 Oct;13 (10) :1776-86.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ZFAND6 sgRNA gene knockout kit - Lentiviral human ZFAND6 sgRNA gene knockout kit (100)
GTR15378400 1 Vial

Lentiviral human ZFAND6 sgRNA gene knockout kit - Lentiviral human ZFAND6 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
RIPK4 Human shRNA Lentiviral Particle (Locus ID 54101)
TL320703V 500 µL Each

RIPK4 Human shRNA Lentiviral Particle (Locus ID 54101)

Sign In for Pricing
View Details
Rai12-set siRNA/shRNA/RNAi Lentivector (Rat)
38454096 4x 500 ng

Rai12-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Genorise® Biotinylated Bovine FGFb polyclonal antibody
GR134016 50 µg

Genorise® Biotinylated Bovine FGFb polyclonal antibody

Sign In for Pricing
View Details
Low Density Lipoprotein Receptor Adapter Protein 1 (LDLRAP1, Autosomal Recessive Hypercholesterolemia Protein, ARH, ARH1, ARH2, DKFZp586D0624, FHCB1, FHCB2, MGC34705, OTTHUMP00000008526) (Azide Free) (FITC)
L3505-50-FITC 100 µL

Low Density Lipoprotein Receptor Adapter Protein 1 (LDLRAP1, Autosomal Recessive Hypercholesterolemia Protein, ARH, ARH1, ARH2, DKFZp586D0624, FHCB1, FHCB2, MGC34705, OTTHUMP00000008526) (Azide Free) (FITC)

Sign In for Pricing
View Details
Interleukin 4 (IL-4, B Cell Stimulatory Factor 1, BSF1, Binetrakin, HCGF, Hodgkin's Cell Growth Factor, IA Inducing Factor, Lymphocyte Stimulatory Factor 1, Macrophage Fusion Factor, Mast Cell Growth Factor 2, MCGF2, MFF, MGC79402, Pitrakinra, T Cell Growth Factor 2, TCGF2) (MaxLight 550)
I8426-16-ML550 100 µL

Interleukin 4 (IL-4, B Cell Stimulatory Factor 1, BSF1, Binetrakin, HCGF, Hodgkin's Cell Growth Factor, IA Inducing Factor, Lymphocyte Stimulatory Factor 1, Macrophage Fusion Factor, Mast Cell Growth Factor 2, MCGF2, MFF, MGC79402, Pitrakinra, T Cell Growth Factor 2, TCGF2) (MaxLight 550)

Sign In for Pricing
View Details