Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GYPA/CD235a, Human (GST)

GYPA, also known as glycoprotein A, is a major membrane protein in red blood cells and plays an important role in the integrity of cell membranes. GYPA is a receptor for influenza virus, Plasmodium falciparum erythrocyte binding Antigen 175 (EBA-175), and hepatitis A virus (HAV) . GYPA/CD235a Protein, Human (GST) is the recombinant human-derived GYPA/CD235a protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

GYPA/CD235a Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gypa-cd235a-protein-human-gst.html

Smiles

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Molecular Formula

2993 (Gene_ID) A0A0C4DFT7 (L20-E91) (Accession)

Molecular Weight

Approximately 34.9 kDa

References & Citations

[1]Suwanwootichai P, et al. Fatal haemolytic transfusion reaction due to anti-Ena and identification of a novel GYPA c.295delG variant in a Thai family. Vox Sang. 2022 Nov;117 (11) :1327-1331.|[2]Bigham AW, et al. Complex signatures of natural selection at GYPA. Hum Genet. 2018 Feb;137 (2) :151-160.|[3]Suades R, et al. Growing thrombi release increased levels of CD235a (+) microparticles and decreased levels of activated platelet-derived microparticles. Validation in ST-elevation myocardial infarction patients. J Thromb Haemost. 2015 Oct;13 (10) :1776-86.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXC6 Recombinant Antibody, Cy7 Conjugated
bsm-62806R-Cy7 100 µL

HOXC6 Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal RTVP-1/GLIPR1 Antibody [Alexa Fluor 594]
NBP2-99206AF594 0.1 mL

Rabbit Polyclonal RTVP-1/GLIPR1 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
BRLF1 Polyclonal Antibody, HRP Conjugated
bs-4542R-HRP 100 µL

BRLF1 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Hpt/HP (Haptoglobin) Human ELISA Kit
E1273 96 Tests

Hpt/HP (Haptoglobin) Human ELISA Kit

Sign In for Pricing
View Details
Porcine Transmembrane Protease Serine 11D (TMPRSS11D) ELISA Kit
MBS9939262-01 48 Well

Porcine Transmembrane Protease Serine 11D (TMPRSS11D) ELISA Kit

Sign In for Pricing
View Details
Porcine Transmembrane Protease Serine 11D (TMPRSS11D) ELISA Kit
MBS9939262-02 96 Well

Porcine Transmembrane Protease Serine 11D (TMPRSS11D) ELISA Kit

Sign In for Pricing
View Details