Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP-7, Human (His)

Bone morphogenetic protein 7 (BMP-7) is a polymorphic ligand protein belonging to the TGF-β family. BMP-7 is involved in regulating the proliferation, invasion and migration of cancer cells and is associated with a variety of human tumors[1]. BMP-7 binds ALK2 or ACVR2A/BMPR2 excitation signal, which is terminated by SMADs regulation[2]. BMP-7 is involved in the BMP-7-SMad1/5/9 signaling pathway, which is associated with the epithelial-mesenchymal transition (EMT) process[1]. BMP-7 also eliminates vascular inflammation, maintains vascular integrity[3], reduces vascular calcification, and stimulates in situ phosphate ossification deposition[4].

Product Specifications

Product Name Alternative

BMP-7 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bmp-7-protein-human-his.html

Purity

95.0

Smiles

STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH

Molecular Formula

655 (Gene_ID) P18075 (S293-H431) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Sun R, et al. Expression of BMP-7 in cervical cancer and inhibition of epithelial‑mesenchymal transition by BMP-7 knockdown in HeLa cells. Int J Mol Med. 2020 May;45 (5) :1417-1424.|[2]Miyazawa K, et al. Regulation of TGF-β Family Signaling by Inhibitory Smads. Cold Spring Harb Perspect Biol. 2017 Mar 1;9 (3) :a022095.|[3]Dorai H, et al. Bone morphogenetic protein-7 (osteogenic protein-1) inhibits smooth muscle cell proliferation and stimulates the expression of markers that are characteristic of SMC phenotype in vitro. J Cell Physiol. 2000 Jul;184 (1) :37-45.|[4]Mathew S, et al. Function and effect of bone morphogenetic protein-7 in kidney bone and the bone-vascular links in chronic kidney disease. Eur J Clin Invest. 2006 Aug;36 Suppl 2:43-50.|[5]Yang P, et al. The role of bone morphogenetic protein signaling in vascular calcification. Bone. 2020 Dec;141:115542.|[6]Xu RH, et al. BMP4 initiates human embryonic stem cell differentiation to trophoblast. Nat Biotechnol. 2002 Dec;20 (12) :1261-4.|[7]Beck HN, et al. Bone morphogenetic protein-5 (BMP-5) promotes dendritic growth in cultured sympathetic neurons. BMC Neurosci. 2001;2:12.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Bovine Perilipin 1 ELISA Kit
MBS745941-01 48 Well

Bovine Perilipin 1 ELISA Kit

Ask
View Details
Bovine Perilipin 1 ELISA Kit
MBS745941-02 96 Well

Bovine Perilipin 1 ELISA Kit

Ask
View Details
Bovine Perilipin 1 ELISA Kit
MBS745941-03 5x 96 Well

Bovine Perilipin 1 ELISA Kit

Ask
View Details
Bovine Perilipin 1 ELISA Kit
MBS745941-04 10x 96 Well

Bovine Perilipin 1 ELISA Kit

Ask
View Details
STK40 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-6899R-APC-Cy5.5 100 µL

STK40 Polyclonal Antibody, APC-Cy5.5 Conjugated

Ask
View Details
Complement factor D-IN-1 10mM * 1mL in DMSO
A20253-10mM-D 10 mM x 1mL in DMSO

Complement factor D-IN-1 10mM * 1mL in DMSO

Ask
View Details