Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Thy1/CD90, Mouse (HEK293, His)

Thy1/CD90 protein may play a role in cell-cell interactions, especially during synaptogenesis in the brain. It facilitates communication and connections between cells, shaping neural network architecture and functionality. Understanding how Thy1/CD90 participates in these interactions can provide insights into its role in brain function and connectivity. Thy1/CD90 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Thy1/CD90 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Thy1/CD90 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thy1-cd90-protein-mouse-hek293-his.html

Purity

95.00

Smiles

QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC

Molecular Formula

21838 (Gene_ID) P01831 (Q20-C131) (Accession)

Molecular Weight

The protein migrates as approximately 17-27 kDa under reducing SDS-PAGE due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), CF640R conjugate, 0.1mg/mL
BNC401930-500 1x 500 µL

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-Aminophthalic Acid Hydrochloride
TRC-A627715-500MG 500 mg

3-Aminophthalic Acid Hydrochloride

Sign In for Pricing
View Details
Inhibin beta A Antibody
KC-684-01 50 μL

Inhibin beta A Antibody

Sign In for Pricing
View Details
Inhibin beta A Antibody
KC-684-02 100 µL

Inhibin beta A Antibody

Sign In for Pricing
View Details
Inhibin beta A Antibody
KC-684-03 1 mL

Inhibin beta A Antibody

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse Ly6G Antibody
RD21317F-01 25 µg

PE/Cyanine5.5 Anti-Mouse Ly6G Antibody

Sign In for Pricing
View Details