Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Thy1/CD90, Mouse (HEK293, His)

Thy1/CD90 protein may play a role in cell-cell interactions, especially during synaptogenesis in the brain. It facilitates communication and connections between cells, shaping neural network architecture and functionality. Understanding how Thy1/CD90 participates in these interactions can provide insights into its role in brain function and connectivity. Thy1/CD90 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Thy1/CD90 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Thy1/CD90 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thy1-cd90-protein-mouse-hek293-his.html

Purity

95.00

Smiles

QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC

Molecular Formula

21838 (Gene_ID) P01831 (Q20-C131) (Accession)

Molecular Weight

The protein migrates as approximately 17-27 kDa under reducing SDS-PAGE due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM192 Human Gene Knockout Kit (CRISPR)
KN418453 1 Kit

TMEM192 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SGK196 (POMK) Rabbit Polyclonal Antibody
TA369557 100 µL

SGK196 (POMK) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ATAD3A Polyclonal Antibody
E-AB-18524-01 20 µL

ATAD3A Polyclonal Antibody

Sign In for Pricing
View Details
ATAD3A Polyclonal Antibody
E-AB-18524-02 60 µL

ATAD3A Polyclonal Antibody

Sign In for Pricing
View Details
ATAD3A Polyclonal Antibody
E-AB-18524-03 120 µL

ATAD3A Polyclonal Antibody

Sign In for Pricing
View Details
ATAD3A Polyclonal Antibody
E-AB-18524-04 200 µL

ATAD3A Polyclonal Antibody

Sign In for Pricing
View Details