Thy1/CD90, Mouse (HEK293, His)
Thy1/CD90 protein may play a role in cell-cell interactions, especially during synaptogenesis in the brain. It facilitates communication and connections between cells, shaping neural network architecture and functionality. Understanding how Thy1/CD90 participates in these interactions can provide insights into its role in brain function and connectivity. Thy1/CD90 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Thy1/CD90 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
Thy1/CD90 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/thy1-cd90-protein-mouse-hek293-his.html
Purity
95.00
Smiles
QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC
Molecular Formula
21838 (Gene_ID) P01831 (Q20-C131) (Accession)
Molecular Weight
The protein migrates as approximately 17-27 kDa under reducing SDS-PAGE due to glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
![IL20 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F3]](https://cdn.genprice.uk/products/937/6868c3bb994c49e6dc3fd4b4/imageurl/ta803544bm.webp)
IL20 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F3]
Carcinoembryonic Antigen (CEA) / CD66 (C66/2055R), CF640R conjugate, 0.1mg/mL
