Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Thy1/CD90, Mouse (HEK293, His)

Thy1/CD90 protein may play a role in cell-cell interactions, especially during synaptogenesis in the brain. It facilitates communication and connections between cells, shaping neural network architecture and functionality. Understanding how Thy1/CD90 participates in these interactions can provide insights into its role in brain function and connectivity. Thy1/CD90 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Thy1/CD90 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Thy1/CD90 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thy1-cd90-protein-mouse-hek293-his.html

Purity

95.00

Smiles

QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC

Molecular Formula

21838 (Gene_ID) P01831 (Q20-C131) (Accession)

Molecular Weight

The protein migrates as approximately 17-27 kDa under reducing SDS-PAGE due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha-2-macroglobulin Mouse Monoclonal Antibody [B1-D7]
M1510-24 100 µL

Alpha-2-macroglobulin Mouse Monoclonal Antibody [B1-D7]

Sign In for Pricing
View Details
Plasma Cell Marker (LIV3G11, same as 7B18), CF568 conjugate, 0.1mg/mL
BNC680047-100 1x 100 µL

Plasma Cell Marker (LIV3G11, same as 7B18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-epi-25-Hydroxy Vitamin D3
TRC-H995860-1MG 1 mg

3-epi-25-Hydroxy Vitamin D3

Sign In for Pricing
View Details
Human STK32A activation kit by CRISPRa
GA116420 1 Kit

Human STK32A activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Immp1l activation kit by CRISPRa
GA206835 1 Kit

Mouse Immp1l activation kit by CRISPRa

Sign In for Pricing
View Details
ZNF32 (NM_001005368) Human Over-expression Lysate
LY423703 100 µg

ZNF32 (NM_001005368) Human Over-expression Lysate

Sign In for Pricing
View Details