Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AQP1, Human (His-SUMO)

The AQP1 protein forms water-specific channels that allow water to cross red blood cells and renal proximal tubule membranes. AQP1 Protein, Human (His-SUMO) is the recombinant human-derived AQP1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

AQP1 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/aqp1-protein-human-his-sumo.html

Smiles

GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

Molecular Formula

358 (Gene_ID) P29972 (G220-K269) (Accession)

Molecular Weight

Approximately 21.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

UAP1L1 Adenovirus (Mouse)
48910054 1.0 mL

UAP1L1 Adenovirus (Mouse)

Ask
View Details
Lentiviral mouse Snrpd3 shRNA (UAS) - Lentiviral mouse Snrpd3 shRNA (UAS, iRFP) (25)
GTR15158294 1 Vial

Lentiviral mouse Snrpd3 shRNA (UAS) - Lentiviral mouse Snrpd3 shRNA (UAS, iRFP) (25)

Ask
View Details
MIS18BP1 (C14orf106, Mis18-binding Protein 1, Kinetochore-associated Protein KNL-2 Homolog, HsKNL-2, P243, KIAA1903, FLJ11186, HSA242977)
129699 50 µg

MIS18BP1 (C14orf106, Mis18-binding Protein 1, Kinetochore-associated Protein KNL-2 Homolog, HsKNL-2, P243, KIAA1903, FLJ11186, HSA242977)

Ask
View Details
GRB2 Recombinant Antibody, PE-Cy5.5 Conjugated
bsm-62088R-PE-Cy5.5 100 µL

GRB2 Recombinant Antibody, PE-Cy5.5 Conjugated

Ask
View Details