Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AQP1, Human (His-SUMO)

The AQP1 protein forms water-specific channels that allow water to cross red blood cells and renal proximal tubule membranes. AQP1 Protein, Human (His-SUMO) is the recombinant human-derived AQP1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

AQP1 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/aqp1-protein-human-his-sumo.html

Smiles

GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

Molecular Formula

358 (Gene_ID) P29972 (G220-K269) (Accession)

Molecular Weight

Approximately 21.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FARP1, NT (FARP1, CDEP, PLEKHC2, FERM, RhoGEF and pleckstrin domain-containing protein 1, Chondrocyte-derived ezrin-like protein, Pleckstrin homology domain-containing family C member 2) (MaxLight 405) discontinued
035515-ML405 100 µL

FARP1, NT (FARP1, CDEP, PLEKHC2, FERM, RhoGEF and pleckstrin domain-containing protein 1, Chondrocyte-derived ezrin-like protein, Pleckstrin homology domain-containing family C member 2) (MaxLight 405) discontinued

Ask
View Details
Spaca1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
45171116 3x 1.0 µg

Spaca1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Ask
View Details
EGF Receptor (Phospho Tyr992) Antibody
A9502-01 50 μL

EGF Receptor (Phospho Tyr992) Antibody

Ask
View Details
EGF Receptor (Phospho Tyr992) Antibody
A9502-02 100 µL

EGF Receptor (Phospho Tyr992) Antibody

Ask
View Details
Srpx Rat shRNA Lentiviral Particle (Locus ID 64316)
TL710722V 500 µL Each

Srpx Rat shRNA Lentiviral Particle (Locus ID 64316)

Ask
View Details
ZFYVE26 (h) -PR
sc-63243-PR 10 µM - 20 µL

ZFYVE26 (h) -PR

Ask
View Details