Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AQP1, Human (His-SUMO)

The AQP1 protein forms water-specific channels that allow water to cross red blood cells and renal proximal tubule membranes. AQP1 Protein, Human (His-SUMO) is the recombinant human-derived AQP1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

AQP1 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/aqp1-protein-human-his-sumo.html

Smiles

GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

Molecular Formula

358 (Gene_ID) P29972 (G220-K269) (Accession)

Molecular Weight

Approximately 21.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

UFD1L Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-9733R-BF750 100 µL

UFD1L Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Ask
View Details
Von Willebrand Factor (VWF) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8A6]
TA803275AM 100 µL

Von Willebrand Factor (VWF) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8A6]

Ask
View Details
Duck WD Repeat-Containing Protein 17 (WDR17) ELISA Kit
MBS9353293 Inquire

Duck WD Repeat-Containing Protein 17 (WDR17) ELISA Kit

Ask
View Details
CCDC137, CT (CCDC137, Coiled-coil domain-containing protein 137) (AP) discontinued
033298-AP 200 µL

CCDC137, CT (CCDC137, Coiled-coil domain-containing protein 137) (AP) discontinued

Ask
View Details
Rat Ythdc2 Pre-designed siRNA Set B
SI216121B 1 Each

Rat Ythdc2 Pre-designed siRNA Set B

Ask
View Details