Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AQP1, Human (His-SUMO)

The AQP1 protein forms water-specific channels that allow water to cross red blood cells and renal proximal tubule membranes. AQP1 Protein, Human (His-SUMO) is the recombinant human-derived AQP1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

AQP1 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/aqp1-protein-human-his-sumo.html

Smiles

GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

Molecular Formula

358 (Gene_ID) P29972 (G220-K269) (Accession)

Molecular Weight

Approximately 21.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GENLISA™ Human RNA-Binding Protein Musashi Homolog 1 (MSI1) ELISA
KBH6663 1x 96 Well

GENLISA™ Human RNA-Binding Protein Musashi Homolog 1 (MSI1) ELISA

Ask
View Details
CYP2A6 (Cytochrome P450 2A6, CYPIIA6, Coumarin 7-hydroxylase, Cytochrome P450 IIA3, Cytochrome P450 (I), CYP2A3) (Biotin)
125573-Biotin 100 µL

CYP2A6 (Cytochrome P450 2A6, CYPIIA6, Coumarin 7-hydroxylase, Cytochrome P450 IIA3, Cytochrome P450 (I), CYP2A3) (Biotin)

Ask
View Details
LentimiRa-hsa-mir-3163 Vector
mh40405 500 ng

LentimiRa-hsa-mir-3163 Vector

Ask
View Details