Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AQP1, Human (His-SUMO)

The AQP1 protein forms water-specific channels that allow water to cross red blood cells and renal proximal tubule membranes. AQP1 Protein, Human (His-SUMO) is the recombinant human-derived AQP1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

AQP1 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/aqp1-protein-human-his-sumo.html

Smiles

GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

Molecular Formula

358 (Gene_ID) P29972 (G220-K269) (Accession)

Molecular Weight

Approximately 21.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

S100a13 3'UTR Lenti-reporter-Luc Vector
42931084 1.0 µg

S100a13 3'UTR Lenti-reporter-Luc Vector

Ask
View Details
Lentiviral human VCAN sgRNA gene knockout kit - Lentiviral human VCAN sgRNA gene knockout kit (100)
GTR15384472 1 Vial

Lentiviral human VCAN sgRNA gene knockout kit - Lentiviral human VCAN sgRNA gene knockout kit (100)

Ask
View Details
CPNE6 Rabbit Polyclonal Antibody
TA370033 100 µL

CPNE6 Rabbit Polyclonal Antibody

Ask
View Details
Sheep Retinoic Acid Induced Protein 3 ELISA Kit
MBS039277-01 48 Well

Sheep Retinoic Acid Induced Protein 3 ELISA Kit

Ask
View Details
Sheep Retinoic Acid Induced Protein 3 ELISA Kit
MBS039277-02 96 Well

Sheep Retinoic Acid Induced Protein 3 ELISA Kit

Ask
View Details
Sheep Retinoic Acid Induced Protein 3 ELISA Kit
MBS039277-03 5x 96 Well

Sheep Retinoic Acid Induced Protein 3 ELISA Kit

Ask
View Details