Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AQP1, Human (His-SUMO)

The AQP1 protein forms water-specific channels that allow water to cross red blood cells and renal proximal tubule membranes. AQP1 Protein, Human (His-SUMO) is the recombinant human-derived AQP1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

AQP1 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/aqp1-protein-human-his-sumo.html

Smiles

GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

Molecular Formula

358 (Gene_ID) P29972 (G220-K269) (Accession)

Molecular Weight

Approximately 21.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Chloride Intracellular Channel 1 (CLIC 1, CLIC1, Chloride Channel ABP, G6, hRNCC, Nuclear Chloride Ion Channel 27, NCC27, p64CLCP, Regulatory Nuclear Chloride Ion Channel Protein, RNCC Protein) (MaxLight 650) discontinued
C4363-10C-ML650 100 µL

Chloride Intracellular Channel 1 (CLIC 1, CLIC1, Chloride Channel ABP, G6, hRNCC, Nuclear Chloride Ion Channel 27, NCC27, p64CLCP, Regulatory Nuclear Chloride Ion Channel Protein, RNCC Protein) (MaxLight 650) discontinued

Ask
View Details
UBP37, NT (USP37, KIAA1594, Ubiquitin carboxyl-terminal hydrolase 37, Deubiquitinating enzyme 37, Ubiquitin thioesterase 37, Ubiquitin-specific-processing protease 37) (MaxLight 490) discontinued
043551-ML490 100 µL

UBP37, NT (USP37, KIAA1594, Ubiquitin carboxyl-terminal hydrolase 37, Deubiquitinating enzyme 37, Ubiquitin thioesterase 37, Ubiquitin-specific-processing protease 37) (MaxLight 490) discontinued

Ask
View Details
LY96, CT (LY96, ESOP1, MD2, Lymphocyte antigen 96, ESOP-1, Protein MD-2) (MaxLight 490) discontinued
038018-ML490 100 µL

LY96, CT (LY96, ESOP1, MD2, Lymphocyte antigen 96, ESOP-1, Protein MD-2) (MaxLight 490) discontinued

Ask
View Details