Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Beta-2-microglobulin (B2M)

Product Specifications

Abbreviation

Recombinant Cat B2M protein

Gene Name

B2M

UniProt

Q5MGS7

Expression Region

21-118aa

Organism

Felis catus (Cat) (Felis silvestris catus)

Target Sequence

VQHSPKVQVYSRHPAENGKPNFLNCYVSGFHPPQIDITLMKNGKKMEAEQTDLSFNRDWTFYLLVHTEFTPTVEDEYSCQVNHTTLSEPKVVKWDRDM

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Component of the class I major histocompatibility complex (MHC) . Involved in the presentation of peptide antigens to the immune system.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Orticumab (Anti-oxLDL)
C00195-1mg 1 mg

Orticumab (Anti-oxLDL)

Sign In for Pricing
View Details
Mouse Monoclonal GCHFR Antibody (GCHFR/7732) [DyLight 488]
NBP3-26939G 0.1 mL

Mouse Monoclonal GCHFR Antibody (GCHFR/7732) [DyLight 488]

Sign In for Pricing
View Details
Human Poly A Specific Ribonuclease (PARN) ELISA Kit
abx152649-01 96 Tests

Human Poly A Specific Ribonuclease (PARN) ELISA Kit

Sign In for Pricing
View Details
Human Poly A Specific Ribonuclease (PARN) ELISA Kit
abx152649-02 5x 96 Tests

Human Poly A Specific Ribonuclease (PARN) ELISA Kit

Sign In for Pricing
View Details
Human Poly A Specific Ribonuclease (PARN) ELISA Kit
abx152649-03 10x 96 Tests

Human Poly A Specific Ribonuclease (PARN) ELISA Kit

Sign In for Pricing
View Details
Monofunctional C1-Tetrahydrofolate Synthase, Mitochondrial (MTHFD1L) Antibody
abx456420-01 50 µg

Monofunctional C1-Tetrahydrofolate Synthase, Mitochondrial (MTHFD1L) Antibody

Sign In for Pricing
View Details