Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TrpA, E.coli

The TrpA protein, especially its α subunit, plays a crucial role in catalyzing the aldol cleavage of indole glycerol phosphate to produce indole and glyceraldehyde 3-phosphate. This enzymatic activity highlights the importance of TrpA in the tryptophan biosynthetic pathway, providing an essential component of cellular processes. TrpA Protein, E.coli is the recombinant E. coli-derived TrpA protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

TrpA Protein, E.coli, E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trpa-protein-e-coli.html

Purity

95.76

Smiles

MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLADGPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEKVGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRAGVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHINEPEKMLAALKVFVQPMKAATRS

Molecular Formula

58388661 (Gene_ID) P0A877 (M1-S268) (Accession)

Molecular Weight

Approximately 26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP90AB1 (NM_001271969) Human Tagged ORF Clone
RC234777 10 µg

HSP90AB1 (NM_001271969) Human Tagged ORF Clone

Sign In for Pricing
View Details
Cat Fibroblast Growth Factor 13 ELISA Kit
MBS080516 Inquire

Cat Fibroblast Growth Factor 13 ELISA Kit

Sign In for Pricing
View Details
ARP3 Polyclonal Antibody Bio Conjugated
C92581Bio 100 µL

ARP3 Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details
Disks Large-Associated Protein 2 (DLGAP2) Antibody (HRP)
abx349252-01 20 µg

Disks Large-Associated Protein 2 (DLGAP2) Antibody (HRP)

Sign In for Pricing
View Details
Disks Large-Associated Protein 2 (DLGAP2) Antibody (HRP)
abx349252-02 50 µg

Disks Large-Associated Protein 2 (DLGAP2) Antibody (HRP)

Sign In for Pricing
View Details
Disks Large-Associated Protein 2 (DLGAP2) Antibody (HRP)
abx349252-03 100 µg

Disks Large-Associated Protein 2 (DLGAP2) Antibody (HRP)

Sign In for Pricing
View Details