Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TrpA, E.coli

The TrpA protein, especially its α subunit, plays a crucial role in catalyzing the aldol cleavage of indole glycerol phosphate to produce indole and glyceraldehyde 3-phosphate. This enzymatic activity highlights the importance of TrpA in the tryptophan biosynthetic pathway, providing an essential component of cellular processes. TrpA Protein, E.coli is the recombinant E. coli-derived TrpA protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

TrpA Protein, E.coli, E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trpa-protein-e-coli.html

Purity

95.76

Smiles

MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLADGPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEKVGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRAGVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHINEPEKMLAALKVFVQPMKAATRS

Molecular Formula

58388661 (Gene_ID) P0A877 (M1-S268) (Accession)

Molecular Weight

Approximately 26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LEFTY1/LEFTY2 Antibody
CSB-PA006317-01 50 µg

LEFTY1/LEFTY2 Antibody

Sign In for Pricing
View Details
LEFTY1/LEFTY2 Antibody
CSB-PA006317-02 100 µg

LEFTY1/LEFTY2 Antibody

Sign In for Pricing
View Details
Human EFNA1 Protein, Fc Tag
KMPH6167 50 µg

Human EFNA1 Protein, Fc Tag

Sign In for Pricing
View Details
CHRNB2 Protein Vector (Rat) (pPM-C-His)
PV259961 500 ng

CHRNB2 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
GRK2 Human Gene Knockout Kit (CRISPR)
KN410327 1 Kit

GRK2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Fmoc-D-Phe (3-F) -OH 1000mg
A23602-1000 1000 mg

Fmoc-D-Phe (3-F) -OH 1000mg

Sign In for Pricing
View Details