Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TrpA, E.coli

The TrpA protein, especially its α subunit, plays a crucial role in catalyzing the aldol cleavage of indole glycerol phosphate to produce indole and glyceraldehyde 3-phosphate. This enzymatic activity highlights the importance of TrpA in the tryptophan biosynthetic pathway, providing an essential component of cellular processes. TrpA Protein, E.coli is the recombinant E. coli-derived TrpA protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

TrpA Protein, E.coli, E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trpa-protein-e-coli.html

Purity

95.76

Smiles

MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLADGPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEKVGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRAGVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHINEPEKMLAALKVFVQPMKAATRS

Molecular Formula

58388661 (Gene_ID) P0A877 (M1-S268) (Accession)

Molecular Weight

Approximately 26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Psmg2 (m) -PR
sc-152564-PR 10 µM - 20 µL

Psmg2 (m) -PR

Sign In for Pricing
View Details
Mouse Ighv16-1 activation kit by CRISPRa
GA218160 1 Kit

Mouse Ighv16-1 activation kit by CRISPRa

Sign In for Pricing
View Details
CREB1 Protein Lysate (Rat) with C-HA Tag
16809037 100 µg

CREB1 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Human anti-21-OH Ab (anti 21-hydroxylase antibody) ELISA Kit
ELK10071-01 48 Tests

Human anti-21-OH Ab (anti 21-hydroxylase antibody) ELISA Kit

Sign In for Pricing
View Details
Human anti-21-OH Ab (anti 21-hydroxylase antibody) ELISA Kit
ELK10071-02 96 Tests

Human anti-21-OH Ab (anti 21-hydroxylase antibody) ELISA Kit

Sign In for Pricing
View Details
Human anti-21-OH Ab (anti 21-hydroxylase antibody) ELISA Kit
ELK10071-03 5x 96 Tests

Human anti-21-OH Ab (anti 21-hydroxylase antibody) ELISA Kit

Sign In for Pricing
View Details