Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TrpA, E.coli

The TrpA protein, especially its α subunit, plays a crucial role in catalyzing the aldol cleavage of indole glycerol phosphate to produce indole and glyceraldehyde 3-phosphate. This enzymatic activity highlights the importance of TrpA in the tryptophan biosynthetic pathway, providing an essential component of cellular processes. TrpA Protein, E.coli is the recombinant E. coli-derived TrpA protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

TrpA Protein, E.coli, E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trpa-protein-e-coli.html

Purity

95.76

Smiles

MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLADGPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEKVGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRAGVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHINEPEKMLAALKVFVQPMKAATRS

Molecular Formula

58388661 (Gene_ID) P0A877 (M1-S268) (Accession)

Molecular Weight

Approximately 26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tfap2a (NM_011547) Mouse Tagged ORF Clone Lentiviral Particle
MR206962L4V 200 µL

Tfap2a (NM_011547) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
rno-miR-6331 miRNA Antagomir
MBS8321145-01 10 nmol

rno-miR-6331 miRNA Antagomir

Sign In for Pricing
View Details
rno-miR-6331 miRNA Antagomir
MBS8321145-02 20 nmol

rno-miR-6331 miRNA Antagomir

Sign In for Pricing
View Details
rno-miR-6331 miRNA Antagomir
MBS8321145-03 5x 20 nmol

rno-miR-6331 miRNA Antagomir

Sign In for Pricing
View Details
Mono-2-ethyl-5-carboxypentyl terephthalate
TYD-03648-01 10 mg

Mono-2-ethyl-5-carboxypentyl terephthalate

Sign In for Pricing
View Details
Mono-2-ethyl-5-carboxypentyl terephthalate
TYD-03648-02 50 mg

Mono-2-ethyl-5-carboxypentyl terephthalate

Sign In for Pricing
View Details