Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP1B1, Human (HEK293, His)

The ATP1B1 protein is the non-catalytic component of ATP hydrolase and promotes Na (+) /K (+) ion exchange across the plasma membrane. Its regulatory role involves the assembly of α/β heterodimers to control sodium pump levels. ATP1B1 Protein, Human (HEK293, His) is the recombinant human-derived ATP1B1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ATP1B1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp1b1-protein-human-hek293-his.html

Purity

96.00

Smiles

EFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS

Molecular Formula

481 (Gene_ID) P05026-1 (E63-S303) (Accession)

Molecular Weight

Approximately 40-50 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prodipine hydrochloride
orb1707863-01 50 mg

Prodipine hydrochloride

Sign In for Pricing
View Details
Prodipine hydrochloride
orb1707863-02 100 mg

Prodipine hydrochloride

Sign In for Pricing
View Details
MEPE (NM_001184694) Human Tagged ORF Clone Lentiviral Particle
RC230233L3V 200 µL

MEPE (NM_001184694) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
WASF2 Antibody
A52159-100UL 100 µL

WASF2 Antibody

Sign In for Pricing
View Details
PIGAP1 sgRNA CRISPR Lentivector (Human) (Target 1)
K1646702 1.0 µg DNA

PIGAP1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Lentiviral human CTXN2 sgRNA gene knockout kit - Lentiviral human CTXN2 sgRNA gene knockout kit (100)
GTR15385297 1 Vial

Lentiviral human CTXN2 sgRNA gene knockout kit - Lentiviral human CTXN2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details