Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBASH3B/STS1, Human (His)

UBASH3B/STS1 protein blocks CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases, leading to the accumulation of activating receptors such as T cell receptors and EGFR on the cell surface. It exhibits tyrosine phosphatase activity against substrates such as EGFR, FAK, SYK and ZAP70. UBASH3B/STS1 Protein, Human (His) is the recombinant human-derived UBASH3B/STS1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

UBASH3B/STS1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ubash3b-sts1-protein-human-his.html

Purity

95.0

Smiles

QKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAHNILKGLQQENHLKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQLTDPPILPLTHGPTGGFNWRETLLQE

Molecular Formula

84959 (Gene_ID) Q8TF42 (Q382-E649) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nipal4 (NM_001106995) Rat Tagged Lenti ORF Clone
RR211172L3 10 µg

Nipal4 (NM_001106995) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TNNT3 Antibody - C-terminal region : FITC (ARP51286_P050-FITC)
ARP51286_P050-FITC 100 µL

TNNT3 Antibody - C-terminal region : FITC (ARP51286_P050-FITC)

Sign In for Pricing
View Details
Recombinant Human IgG3 Fc Fragment
HV755011-01 50 µg

Recombinant Human IgG3 Fc Fragment

Sign In for Pricing
View Details
Recombinant Human IgG3 Fc Fragment
HV755011-02 100 µg

Recombinant Human IgG3 Fc Fragment

Sign In for Pricing
View Details
Recombinant Human IgG3 Fc Fragment
HV755011-03 1 mg

Recombinant Human IgG3 Fc Fragment

Sign In for Pricing
View Details
Goat Protein FAM13A (FAM13A) ELISA Kit
MBS9935095 Inquire

Goat Protein FAM13A (FAM13A) ELISA Kit

Sign In for Pricing
View Details