Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALNT2, Human (HEK293, His)

The GALNT2 protein catalyzes the initial steps in O-linked oligosaccharide biosynthesis by transferring N-acetyl-D-galactosamine to a protein receptor. GALNT2 Protein, Human (HEK293, His) is the recombinant human-derived GALNT2 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

GALNT2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/galnt2-protein-human-hek293-his.html

Purity

97.40

Smiles

KKKDLHHSNGEEKAQSMETLPPGKVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQQ

Molecular Formula

2590 (Gene_ID) Q10471-1/NP_004472.1 (K52-Q571) (Accession)

Molecular Weight

Approximately 63 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-STK38L antibody
STJ117601 100 µl

Anti-STK38L antibody

Sign In for Pricing
View Details
RPL23AP51 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1943407 1.0 µg DNA

RPL23AP51 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
US27 (NC_006273) Virus Tagged ORF Clone
VC101343 10 µg

US27 (NC_006273) Virus Tagged ORF Clone

Sign In for Pricing
View Details
Human CLCNKB qPCR Primer Pair
QH12081S 200 Tests

Human CLCNKB qPCR Primer Pair

Sign In for Pricing
View Details
Rabbit anti-EIF3L Antibody, Affinity Purified
MBS3904919-01 0.01 mg

Rabbit anti-EIF3L Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-EIF3L Antibody, Affinity Purified
MBS3904919-02 0.1 mg

Rabbit anti-EIF3L Antibody, Affinity Purified

Sign In for Pricing
View Details