Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD226 antigen (CD226), partial, Biotinylated

Product Specifications

Product Name Alternative

DNAX accessory molecule 1 (DNAM-1) ; CD226

Abbreviation

Recombinant Human CD226 protein, partial, Biotinylated

Gene Name

CD226

UniProt

Q15762

Expression Region

19-247aa

Organism

Homo sapiens (Human)

Target Sequence

EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN

Tag

C-terminal 6xHis-Avi-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Involved in intercellular adhesion, lymphocyte signaling, cytotoxicity and lymphokine secretion mediated by cytotoxic T-lymphocyte (CTL) and NK cell. Cell surface receptor for NECTIN2. Upon ligand binding, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Competes with PVRIG for NECTIN2-binding.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAX1BP3 CRISPRa sgRNA lentivector (set of three targets)(Rat)
46221126 3x 1.0µg DNA

TAX1BP3 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
DOCK10 3'UTR GFP Stable Cell Line
TU056240 1.0 mL

DOCK10 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
MED26 (Mediator of RNA Polymerase II Transcription Subunit 26, Activator-recruited Cofactor 70kD Component, ARC70, Cofactor Required for Sp1 Transcriptional Activation Subunit 7, CRSP Complex Subunit 7, Mediator Complex Subunit 26, Transcriptional Coactiv
MBS6385210-01 0.1 mL

MED26 (Mediator of RNA Polymerase II Transcription Subunit 26, Activator-recruited Cofactor 70kD Component, ARC70, Cofactor Required for Sp1 Transcriptional Activation Subunit 7, CRSP Complex Subunit 7, Mediator Complex Subunit 26, Transcriptional Coactiv

Sign In for Pricing
View Details
MED26 (Mediator of RNA Polymerase II Transcription Subunit 26, Activator-recruited Cofactor 70kD Component, ARC70, Cofactor Required for Sp1 Transcriptional Activation Subunit 7, CRSP Complex Subunit 7, Mediator Complex Subunit 26, Transcriptional Coactiv
MBS6385210-02 5x 0.1 mL

MED26 (Mediator of RNA Polymerase II Transcription Subunit 26, Activator-recruited Cofactor 70kD Component, ARC70, Cofactor Required for Sp1 Transcriptional Activation Subunit 7, CRSP Complex Subunit 7, Mediator Complex Subunit 26, Transcriptional Coactiv

Sign In for Pricing
View Details
Phospho-NPTX1 (Tyr344) Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-5527R-BF350 100 µL

Phospho-NPTX1 (Tyr344) Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Phospho-PAK3 (Ser139) Rabbit Polyclonal Antibody (HRP)
orb503998 100 µL

Phospho-PAK3 (Ser139) Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details