Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ST6GAL1, Rat (HEK293, His)

The ST6GAL1 protein is responsible for facilitating the transfer of sialic acid from CMP-sialic acid to galactose-containing receptor substrates. Sialic acid is an important component of a variety of glycoproteins and glycolipids, and ST6GAL1 protein-mediated sialic acid transfer plays a crucial role in regulating the structure and function of these molecules. ST6GAL1 Protein, Rat (HEK293, His) is the recombinant rat-derived ST6GAL1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ST6GAL1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/st6gal1-protein-rat-hek293-his.html

Purity

96.00

Smiles

KKGSDYEALTLQAKEFQMPKSQEKVAMGSASQVVFSNSKQDPKEDIPILSYHRVTAKVKPQPSFQVWDKDSTYSKLNPRLLKIWRNYLNMNKYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKVGPWQRCAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGSKTTIRLMNSQLVTTEKRFLKDSLYTEGILIVWDPSVYHADIPKWYQKPDYNFFETYKSYRRLNPSQPFYILKPQMPWELWDIIQEISADLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNIRC

Molecular Formula

25197 (Gene_ID) P13721-1/NP_001106815.1 (K27-C403) (Accession)

Molecular Weight

Approximately 47-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Campylobacter Jejuni ruvC Protein (aa 1-160) (strain RM1221)
VAng-Ly2939-500gEcoli 500 µg (E. coli)

Recombinant Campylobacter Jejuni ruvC Protein (aa 1-160) (strain RM1221)

Sign In for Pricing
View Details
Human CD20 Alexa Fluor 350 MAb (Cl 2709D)
FAB42252U-100UG 100 µg

Human CD20 Alexa Fluor 350 MAb (Cl 2709D)

Sign In for Pricing
View Details
Rabbit Monoclonal IGFBP-3 Antibody (008) [DyLight 755]
NBP2-89495IR 0.1 mL

Rabbit Monoclonal IGFBP-3 Antibody (008) [DyLight 755]

Sign In for Pricing
View Details
TRNAP17 sgRNA CRISPR Lentivector (Human) (Target 1)
K2511702 1.0 µg DNA

TRNAP17 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
C1orf65 (CCDC185) (NM_152610) Human Over-expression Lysate
LS164127-100ug 100 µg

C1orf65 (CCDC185) (NM_152610) Human Over-expression Lysate

Sign In for Pricing
View Details
Kdm1b sgRNA CRISPR Lentivector (Rat) (Target 1)
K7601202 1.0 µg DNA

Kdm1b sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details