Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ST6GAL1, Rat (HEK293, His)

The ST6GAL1 protein is responsible for facilitating the transfer of sialic acid from CMP-sialic acid to galactose-containing receptor substrates. Sialic acid is an important component of a variety of glycoproteins and glycolipids, and ST6GAL1 protein-mediated sialic acid transfer plays a crucial role in regulating the structure and function of these molecules. ST6GAL1 Protein, Rat (HEK293, His) is the recombinant rat-derived ST6GAL1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ST6GAL1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/st6gal1-protein-rat-hek293-his.html

Purity

96.00

Smiles

KKGSDYEALTLQAKEFQMPKSQEKVAMGSASQVVFSNSKQDPKEDIPILSYHRVTAKVKPQPSFQVWDKDSTYSKLNPRLLKIWRNYLNMNKYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKVGPWQRCAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGSKTTIRLMNSQLVTTEKRFLKDSLYTEGILIVWDPSVYHADIPKWYQKPDYNFFETYKSYRRLNPSQPFYILKPQMPWELWDIIQEISADLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNIRC

Molecular Formula

25197 (Gene_ID) P13721-1/NP_001106815.1 (K27-C403) (Accession)

Molecular Weight

Approximately 47-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bromoxynil (Benzene-13C6)
TRC-B689177-5MG 5 mg

Bromoxynil (Benzene-13C6)

Sign In for Pricing
View Details
CD42a (GP9) (NM_000174) Human Over-expression Lysate
LC424886 20 µg

CD42a (GP9) (NM_000174) Human Over-expression Lysate

Sign In for Pricing
View Details
Vmn1r44 (NM_053227) Mouse Untagged Clone
MC212254 10 µg

Vmn1r44 (NM_053227) Mouse Untagged Clone

Sign In for Pricing
View Details
Mouse Prr29 Pre-designed siRNA Set A
SI111234A 1 Each

Mouse Prr29 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mouse Reversion-inducing cysteine-rich protein with Kazal motifs (RECK) ELISA Kit
abx520262 96 Tests

Mouse Reversion-inducing cysteine-rich protein with Kazal motifs (RECK) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human SURF6 shRNA (UAS) - Lentiviral human SURF6 shRNA (UAS, iRFP) (100)
GTR15337038 1 Vial

Lentiviral human SURF6 shRNA (UAS) - Lentiviral human SURF6 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details