Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ST6GAL1, Rat (HEK293, His)

The ST6GAL1 protein is responsible for facilitating the transfer of sialic acid from CMP-sialic acid to galactose-containing receptor substrates. Sialic acid is an important component of a variety of glycoproteins and glycolipids, and ST6GAL1 protein-mediated sialic acid transfer plays a crucial role in regulating the structure and function of these molecules. ST6GAL1 Protein, Rat (HEK293, His) is the recombinant rat-derived ST6GAL1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ST6GAL1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/st6gal1-protein-rat-hek293-his.html

Purity

96.00

Smiles

KKGSDYEALTLQAKEFQMPKSQEKVAMGSASQVVFSNSKQDPKEDIPILSYHRVTAKVKPQPSFQVWDKDSTYSKLNPRLLKIWRNYLNMNKYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKVGPWQRCAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGSKTTIRLMNSQLVTTEKRFLKDSLYTEGILIVWDPSVYHADIPKWYQKPDYNFFETYKSYRRLNPSQPFYILKPQMPWELWDIIQEISADLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNIRC

Molecular Formula

25197 (Gene_ID) P13721-1/NP_001106815.1 (K27-C403) (Accession)

Molecular Weight

Approximately 47-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF126P1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1837908 1.0 µg DNA

RNF126P1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
ADAM10 Mouse Monoclonal Antibody
AMM82464-01 1 Each

ADAM10 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
ADAM10 Mouse Monoclonal Antibody
AMM82464-02 50 µL

ADAM10 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
ADAM10 Mouse Monoclonal Antibody
AMM82464-03 100 µL

ADAM10 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal NT-3 Antibody [Alexa Fluor 488]
NBP2-99182AF488 0.1 mL

Rabbit Polyclonal NT-3 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Catenin alpha 3 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-62420R-BF750 100 µL

Catenin alpha 3 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details