Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ST6GAL1, Rat (HEK293, His)

The ST6GAL1 protein is responsible for facilitating the transfer of sialic acid from CMP-sialic acid to galactose-containing receptor substrates. Sialic acid is an important component of a variety of glycoproteins and glycolipids, and ST6GAL1 protein-mediated sialic acid transfer plays a crucial role in regulating the structure and function of these molecules. ST6GAL1 Protein, Rat (HEK293, His) is the recombinant rat-derived ST6GAL1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ST6GAL1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/st6gal1-protein-rat-hek293-his.html

Purity

96.00

Smiles

KKGSDYEALTLQAKEFQMPKSQEKVAMGSASQVVFSNSKQDPKEDIPILSYHRVTAKVKPQPSFQVWDKDSTYSKLNPRLLKIWRNYLNMNKYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKVGPWQRCAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGSKTTIRLMNSQLVTTEKRFLKDSLYTEGILIVWDPSVYHADIPKWYQKPDYNFFETYKSYRRLNPSQPFYILKPQMPWELWDIIQEISADLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNIRC

Molecular Formula

25197 (Gene_ID) P13721-1/NP_001106815.1 (K27-C403) (Accession)

Molecular Weight

Approximately 47-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

(+/-) -Cloprostenol sodium salt hydrate
GP0916-5mg 5 mg

(+/-) -Cloprostenol sodium salt hydrate

Sign In for Pricing
View Details
Clnk sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3920108 1.0 µg DNA

Clnk sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
CEPT1 Human Pre-designed siRNA Set A
HY-RS02531 1 Set

CEPT1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Peroxiredoxin 1 (PRDX1) (NM_002574) Human Over-expression Lysate
LH06251V 100 µg

Peroxiredoxin 1 (PRDX1) (NM_002574) Human Over-expression Lysate

Sign In for Pricing
View Details
White spot syndrome virus One-Step PCR kit
Oneq-V249-50D 50T

White spot syndrome virus One-Step PCR kit

Sign In for Pricing
View Details
C13orf31 (LACC1) (NM_153218) Human Tagged Lenti ORF Clone
RC207834L1 10 µg

C13orf31 (LACC1) (NM_153218) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details