Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ST6GAL1, Rat (HEK293, His)

The ST6GAL1 protein is responsible for facilitating the transfer of sialic acid from CMP-sialic acid to galactose-containing receptor substrates. Sialic acid is an important component of a variety of glycoproteins and glycolipids, and ST6GAL1 protein-mediated sialic acid transfer plays a crucial role in regulating the structure and function of these molecules. ST6GAL1 Protein, Rat (HEK293, His) is the recombinant rat-derived ST6GAL1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ST6GAL1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/st6gal1-protein-rat-hek293-his.html

Purity

96.00

Smiles

KKGSDYEALTLQAKEFQMPKSQEKVAMGSASQVVFSNSKQDPKEDIPILSYHRVTAKVKPQPSFQVWDKDSTYSKLNPRLLKIWRNYLNMNKYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKVGPWQRCAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGSKTTIRLMNSQLVTTEKRFLKDSLYTEGILIVWDPSVYHADIPKWYQKPDYNFFETYKSYRRLNPSQPFYILKPQMPWELWDIIQEISADLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNIRC

Molecular Formula

25197 (Gene_ID) P13721-1/NP_001106815.1 (K27-C403) (Accession)

Molecular Weight

Approximately 47-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parva (NM_020606) Mouse Tagged ORF Clone Lentiviral Particle
MR205736L4V 200 µL

Parva (NM_020606) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral mouse Necab2 shRNA (UAS) - Lentiviral mouse Necab2 shRNA (UAS, RFP) plasmid
GTR15292813 1 Vial

Lentiviral mouse Necab2 shRNA (UAS) - Lentiviral mouse Necab2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Rat cholecystokinin 8 (CCk-8) ELISA Kit
YP-W34591-01 48 Tests

Rat cholecystokinin 8 (CCk-8) ELISA Kit

Sign In for Pricing
View Details
Rat cholecystokinin 8 (CCk-8) ELISA Kit
YP-W34591-02 96 Tests

Rat cholecystokinin 8 (CCk-8) ELISA Kit

Sign In for Pricing
View Details
TRNAV21 ORF Vector (Human) (pORF)
ORF035108 1.0 µg DNA

TRNAV21 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Ptpn3 Mouse qPCR Primer Pair (NM_011207)
MP212062 200 Reactions

Ptpn3 Mouse qPCR Primer Pair (NM_011207)

Sign In for Pricing
View Details