Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ST6GAL1, Rat (HEK293, His)

The ST6GAL1 protein is responsible for facilitating the transfer of sialic acid from CMP-sialic acid to galactose-containing receptor substrates. Sialic acid is an important component of a variety of glycoproteins and glycolipids, and ST6GAL1 protein-mediated sialic acid transfer plays a crucial role in regulating the structure and function of these molecules. ST6GAL1 Protein, Rat (HEK293, His) is the recombinant rat-derived ST6GAL1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ST6GAL1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/st6gal1-protein-rat-hek293-his.html

Purity

96.00

Smiles

KKGSDYEALTLQAKEFQMPKSQEKVAMGSASQVVFSNSKQDPKEDIPILSYHRVTAKVKPQPSFQVWDKDSTYSKLNPRLLKIWRNYLNMNKYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKVGPWQRCAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGSKTTIRLMNSQLVTTEKRFLKDSLYTEGILIVWDPSVYHADIPKWYQKPDYNFFETYKSYRRLNPSQPFYILKPQMPWELWDIIQEISADLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNIRC

Molecular Formula

25197 (Gene_ID) P13721-1/NP_001106815.1 (K27-C403) (Accession)

Molecular Weight

Approximately 47-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXA1 (Forkhead Box A1, Hepatocyte Nuclear Factor 3 alpha, HNF3A, MGC33105, TCF3A) (AP) discontinued
F9045-02A-AP 100 µL

FOXA1 (Forkhead Box A1, Hepatocyte Nuclear Factor 3 alpha, HNF3A, MGC33105, TCF3A) (AP) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal S100P binding protein Antibody
NBP1-56954 100 µL

Rabbit Polyclonal S100P binding protein Antibody

Sign In for Pricing
View Details
Senp5 AAV siRNA Pooled Vector
43374164 1.0 µg

Senp5 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
NFASC sgRNA CRISPR Lentivector (Human) (Target 2)
K1420903 1.0 µg DNA

NFASC sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
RBBP9 Protein Vector (Human) (pPM-C-HA)
PV034499 500 ng

RBBP9 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Nkx-2.4 Polyclonal Antibody
MBS2535489-01 0.02 mL

Nkx-2.4 Polyclonal Antibody

Sign In for Pricing
View Details