Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ST6GAL1, Rat (HEK293, His)

The ST6GAL1 protein is responsible for facilitating the transfer of sialic acid from CMP-sialic acid to galactose-containing receptor substrates. Sialic acid is an important component of a variety of glycoproteins and glycolipids, and ST6GAL1 protein-mediated sialic acid transfer plays a crucial role in regulating the structure and function of these molecules. ST6GAL1 Protein, Rat (HEK293, His) is the recombinant rat-derived ST6GAL1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ST6GAL1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/st6gal1-protein-rat-hek293-his.html

Purity

96.00

Smiles

KKGSDYEALTLQAKEFQMPKSQEKVAMGSASQVVFSNSKQDPKEDIPILSYHRVTAKVKPQPSFQVWDKDSTYSKLNPRLLKIWRNYLNMNKYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKVGPWQRCAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGSKTTIRLMNSQLVTTEKRFLKDSLYTEGILIVWDPSVYHADIPKWYQKPDYNFFETYKSYRRLNPSQPFYILKPQMPWELWDIIQEISADLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNIRC

Molecular Formula

25197 (Gene_ID) P13721-1/NP_001106815.1 (K27-C403) (Accession)

Molecular Weight

Approximately 47-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP Kinase 14 (Thr180/Tyr182) (Mitogen-activated Protein Kinase 14, MAPK 14, MAPK14, Mitogen-activated Protein Kinase p38alpha, MAP Kinase p38alpha, Cytokine Suppressive Anti-inflammatory Drug binding Protein, CSAID Binding Protein, CSBP, MAX-interacting Protein 2, MAP Kinase MXI2, SAPK2A) (MaxLight 550) discontinued
M2352-03W-ML550 100 µL

MAP Kinase 14 (Thr180/Tyr182) (Mitogen-activated Protein Kinase 14, MAPK 14, MAPK14, Mitogen-activated Protein Kinase p38alpha, MAP Kinase p38alpha, Cytokine Suppressive Anti-inflammatory Drug binding Protein, CSAID Binding Protein, CSBP, MAX-interacting Protein 2, MAP Kinase MXI2, SAPK2A) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Human fumarase/fumarate hydratase, FUM ELISA Kit
CK-bio-11554-01 48 Tests

Human fumarase/fumarate hydratase, FUM ELISA Kit

Sign In for Pricing
View Details
Human fumarase/fumarate hydratase, FUM ELISA Kit
CK-bio-11554-02 96 Tests

Human fumarase/fumarate hydratase, FUM ELISA Kit

Sign In for Pricing
View Details
Human fumarase/fumarate hydratase, FUM ELISA Kit
CK-bio-11554-03 5x 96 Tests

Human fumarase/fumarate hydratase, FUM ELISA Kit

Sign In for Pricing
View Details
Human fumarase/fumarate hydratase, FUM ELISA Kit
CK-bio-11554-04 10x 96 Tests

Human fumarase/fumarate hydratase, FUM ELISA Kit

Sign In for Pricing
View Details
NEK10 (NM_001031741) Human Over-expression Lysate
LY422186 100 µg

NEK10 (NM_001031741) Human Over-expression Lysate

Sign In for Pricing
View Details