Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ST6GAL1, Rat (HEK293, His)

The ST6GAL1 protein is responsible for facilitating the transfer of sialic acid from CMP-sialic acid to galactose-containing receptor substrates. Sialic acid is an important component of a variety of glycoproteins and glycolipids, and ST6GAL1 protein-mediated sialic acid transfer plays a crucial role in regulating the structure and function of these molecules. ST6GAL1 Protein, Rat (HEK293, His) is the recombinant rat-derived ST6GAL1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ST6GAL1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/st6gal1-protein-rat-hek293-his.html

Purity

96.00

Smiles

KKGSDYEALTLQAKEFQMPKSQEKVAMGSASQVVFSNSKQDPKEDIPILSYHRVTAKVKPQPSFQVWDKDSTYSKLNPRLLKIWRNYLNMNKYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKVGPWQRCAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGSKTTIRLMNSQLVTTEKRFLKDSLYTEGILIVWDPSVYHADIPKWYQKPDYNFFETYKSYRRLNPSQPFYILKPQMPWELWDIIQEISADLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNIRC

Molecular Formula

25197 (Gene_ID) P13721-1/NP_001106815.1 (K27-C403) (Accession)

Molecular Weight

Approximately 47-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Paeoniflorigenone
381034 5 mg

Paeoniflorigenone

Sign In for Pricing
View Details
Prolactin Receptor (Biotin)
549488 200 µL

Prolactin Receptor (Biotin)

Sign In for Pricing
View Details
Canine Ntrk2 Protein, Fc Tag
PCA158 100 µg

Canine Ntrk2 Protein, Fc Tag

Sign In for Pricing
View Details
Mouse Monoclonal Carbonic Anhydrase IX/CA9 Antibody (2D3) [Alexa Fluor 405]
NBP1-51691AF405 0.1 mL

Mouse Monoclonal Carbonic Anhydrase IX/CA9 Antibody (2D3) [Alexa Fluor 405]

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Karyopherin Alpha 2 (KPNa2)
MBS2136547-01 0.1 mL

FITC Linked Monoclonal Antibody to Karyopherin Alpha 2 (KPNa2)

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Karyopherin Alpha 2 (KPNa2)
MBS2136547-02 0.2 mL

FITC Linked Monoclonal Antibody to Karyopherin Alpha 2 (KPNa2)

Sign In for Pricing
View Details