Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ST6GAL1, Rat (HEK293, His)

The ST6GAL1 protein is responsible for facilitating the transfer of sialic acid from CMP-sialic acid to galactose-containing receptor substrates. Sialic acid is an important component of a variety of glycoproteins and glycolipids, and ST6GAL1 protein-mediated sialic acid transfer plays a crucial role in regulating the structure and function of these molecules. ST6GAL1 Protein, Rat (HEK293, His) is the recombinant rat-derived ST6GAL1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ST6GAL1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/st6gal1-protein-rat-hek293-his.html

Purity

96.00

Smiles

KKGSDYEALTLQAKEFQMPKSQEKVAMGSASQVVFSNSKQDPKEDIPILSYHRVTAKVKPQPSFQVWDKDSTYSKLNPRLLKIWRNYLNMNKYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKVGPWQRCAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGSKTTIRLMNSQLVTTEKRFLKDSLYTEGILIVWDPSVYHADIPKWYQKPDYNFFETYKSYRRLNPSQPFYILKPQMPWELWDIIQEISADLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNIRC

Molecular Formula

25197 (Gene_ID) P13721-1/NP_001106815.1 (K27-C403) (Accession)

Molecular Weight

Approximately 47-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERLEC1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV651913 1.0 µg DNA

ERLEC1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
IGLC1 Protein Vector (Human) (pPB-C-His)
PV021117 500 ng

IGLC1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
RBP4 Antibody / Retinol Binding Protein 4
V8708SAF-100UG 100 µg

RBP4 Antibody / Retinol Binding Protein 4

Sign In for Pricing
View Details
Recombinant Rhizobium sp. Putative ferredoxin-3 (fdxB)
MBS1170210-01 0.02 mg (E-Coli)

Recombinant Rhizobium sp. Putative ferredoxin-3 (fdxB)

Sign In for Pricing
View Details
Recombinant Rhizobium sp. Putative ferredoxin-3 (fdxB)
MBS1170210-02 0.1 mg (E-Coli)

Recombinant Rhizobium sp. Putative ferredoxin-3 (fdxB)

Sign In for Pricing
View Details
Recombinant Rhizobium sp. Putative ferredoxin-3 (fdxB)
MBS1170210-03 0.02 mg (Yeast)

Recombinant Rhizobium sp. Putative ferredoxin-3 (fdxB)

Sign In for Pricing
View Details