Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ST6GAL1, Rat (HEK293, His)

The ST6GAL1 protein is responsible for facilitating the transfer of sialic acid from CMP-sialic acid to galactose-containing receptor substrates. Sialic acid is an important component of a variety of glycoproteins and glycolipids, and ST6GAL1 protein-mediated sialic acid transfer plays a crucial role in regulating the structure and function of these molecules. ST6GAL1 Protein, Rat (HEK293, His) is the recombinant rat-derived ST6GAL1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ST6GAL1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/st6gal1-protein-rat-hek293-his.html

Purity

96.00

Smiles

KKGSDYEALTLQAKEFQMPKSQEKVAMGSASQVVFSNSKQDPKEDIPILSYHRVTAKVKPQPSFQVWDKDSTYSKLNPRLLKIWRNYLNMNKYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKVGPWQRCAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGSKTTIRLMNSQLVTTEKRFLKDSLYTEGILIVWDPSVYHADIPKWYQKPDYNFFETYKSYRRLNPSQPFYILKPQMPWELWDIIQEISADLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNIRC

Molecular Formula

25197 (Gene_ID) P13721-1/NP_001106815.1 (K27-C403) (Accession)

Molecular Weight

Approximately 47-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Haptoglobin Antibody (HP/4815) [DyLight 350]
NBP3-26949UV 0.1 mL

Mouse Monoclonal Haptoglobin Antibody (HP/4815) [DyLight 350]

Sign In for Pricing
View Details
L-Glutamic Acid Monoammonium Salt
TRC-G597140-10G 10 g

L-Glutamic Acid Monoammonium Salt

Sign In for Pricing
View Details
Mouse IQ domain-containing protein F1, Iqcf1 ELISA KIT
ELI-43461m 96 Tests

Mouse IQ domain-containing protein F1, Iqcf1 ELISA KIT

Sign In for Pricing
View Details
SNAI 1 Antibody
B1235-01 50 μL

SNAI 1 Antibody

Sign In for Pricing
View Details
SNAI 1 Antibody
B1235-02 100 µL

SNAI 1 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Cytokeratin 8/18 Antibody (KRT8.18/1346) [mFluor Violet 610 SE]
NBP2-54520MFV610 0.1 mL

Mouse Monoclonal Cytokeratin 8/18 Antibody (KRT8.18/1346) [mFluor Violet 610 SE]

Sign In for Pricing
View Details