Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ST6GAL1, Rat (HEK293, His)

The ST6GAL1 protein is responsible for facilitating the transfer of sialic acid from CMP-sialic acid to galactose-containing receptor substrates. Sialic acid is an important component of a variety of glycoproteins and glycolipids, and ST6GAL1 protein-mediated sialic acid transfer plays a crucial role in regulating the structure and function of these molecules. ST6GAL1 Protein, Rat (HEK293, His) is the recombinant rat-derived ST6GAL1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ST6GAL1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/st6gal1-protein-rat-hek293-his.html

Purity

96.00

Smiles

KKGSDYEALTLQAKEFQMPKSQEKVAMGSASQVVFSNSKQDPKEDIPILSYHRVTAKVKPQPSFQVWDKDSTYSKLNPRLLKIWRNYLNMNKYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKVGPWQRCAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGSKTTIRLMNSQLVTTEKRFLKDSLYTEGILIVWDPSVYHADIPKWYQKPDYNFFETYKSYRRLNPSQPFYILKPQMPWELWDIIQEISADLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNIRC

Molecular Formula

25197 (Gene_ID) P13721-1/NP_001106815.1 (K27-C403) (Accession)

Molecular Weight

Approximately 47-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC679651 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6563503 1.0 µg DNA

LOC679651 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
CD83 (CD83 Molecule, BL11, HB15) (PE)
244425-PE 100 µL

CD83 (CD83 Molecule, BL11, HB15) (PE)

Sign In for Pricing
View Details
GALNT11 Protein Vector (Rat) (pPB-C-His)
PV269550 500 ng

GALNT11 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
F12, NT (F12, Coagulation factor XII, Hageman factor, Coagulation factor XIIa heavy chain, Beta-factor XIIa part 1, Beta-factor XIIa part 2, Coagulation factor XIIa light chain) (MaxLight 550) discontinued
035300-ML550 100 µL

F12, NT (F12, Coagulation factor XII, Hageman factor, Coagulation factor XIIa heavy chain, Beta-factor XIIa part 1, Beta-factor XIIa part 2, Coagulation factor XIIa light chain) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Psmb3 sgRNA CRISPR Lentivector set (Mouse)
K3926201 3x 1.0 µg

Psmb3 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
pCMV-SPORT6-ACOX3 Plasmid
PVT13796 2 µg

pCMV-SPORT6-ACOX3 Plasmid

Sign In for Pricing
View Details