Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ST6GAL1, Rat (HEK293, His)

The ST6GAL1 protein is responsible for facilitating the transfer of sialic acid from CMP-sialic acid to galactose-containing receptor substrates. Sialic acid is an important component of a variety of glycoproteins and glycolipids, and ST6GAL1 protein-mediated sialic acid transfer plays a crucial role in regulating the structure and function of these molecules. ST6GAL1 Protein, Rat (HEK293, His) is the recombinant rat-derived ST6GAL1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ST6GAL1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/st6gal1-protein-rat-hek293-his.html

Purity

96.00

Smiles

KKGSDYEALTLQAKEFQMPKSQEKVAMGSASQVVFSNSKQDPKEDIPILSYHRVTAKVKPQPSFQVWDKDSTYSKLNPRLLKIWRNYLNMNKYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKVGPWQRCAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGSKTTIRLMNSQLVTTEKRFLKDSLYTEGILIVWDPSVYHADIPKWYQKPDYNFFETYKSYRRLNPSQPFYILKPQMPWELWDIIQEISADLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNIRC

Molecular Formula

25197 (Gene_ID) P13721-1/NP_001106815.1 (K27-C403) (Accession)

Molecular Weight

Approximately 47-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Affinity Purified Anti-HUMAN IgG F(ab )2 (RABBIT)
GWB-43F409 10 mg

Affinity Purified Anti-HUMAN IgG F(ab )2 (RABBIT)

Sign In for Pricing
View Details
RANGE 2 - Safety storage Cabinet for Flammable products - 340 L - Self-closing doors
SC90J each

RANGE 2 - Safety storage Cabinet for Flammable products - 340 L - Self-closing doors

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) FH19 Polyclonal Antibody
MBS9011677 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) FH19 Polyclonal Antibody

Sign In for Pricing
View Details
YY1 CRISPR Knock Out 293T Cell Line (Human)
50665141 1x 10^6 Cells / 1.0 mL

YY1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Ceacam3 3'UTR Luciferase Stable Cell Line
TU103685 1.0 mL

Ceacam3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Cork Press
2031160 1 Each

Cork Press

Sign In for Pricing
View Details