Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ST6GAL1, Rat (HEK293, His)

The ST6GAL1 protein is responsible for facilitating the transfer of sialic acid from CMP-sialic acid to galactose-containing receptor substrates. Sialic acid is an important component of a variety of glycoproteins and glycolipids, and ST6GAL1 protein-mediated sialic acid transfer plays a crucial role in regulating the structure and function of these molecules. ST6GAL1 Protein, Rat (HEK293, His) is the recombinant rat-derived ST6GAL1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

ST6GAL1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/st6gal1-protein-rat-hek293-his.html

Purity

96.00

Smiles

KKGSDYEALTLQAKEFQMPKSQEKVAMGSASQVVFSNSKQDPKEDIPILSYHRVTAKVKPQPSFQVWDKDSTYSKLNPRLLKIWRNYLNMNKYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKVGPWQRCAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGSKTTIRLMNSQLVTTEKRFLKDSLYTEGILIVWDPSVYHADIPKWYQKPDYNFFETYKSYRRLNPSQPFYILKPQMPWELWDIIQEISADLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNIRC

Molecular Formula

25197 (Gene_ID) P13721-1/NP_001106815.1 (K27-C403) (Accession)

Molecular Weight

Approximately 47-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSG8 (NM_001130168) Human Tagged Lenti ORF Clone
RC225410L3 10 µg

PSG8 (NM_001130168) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Cdk10 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4145902 1.0 µg DNA

Cdk10 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
ZNF277 CRISPRa sgRNA lentivector (set of three targets)(Human)
51404121 3x 1.0µg DNA

ZNF277 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
MAC13243 10mM * 1mL in DMSO
A21943-10mM-D 10 mM x 1mL in DMSO

MAC13243 10mM * 1mL in DMSO

Sign In for Pricing
View Details
Daglb 3'UTR GFP Stable Cell Line
TU154839 1.0 mL

Daglb 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Proteasome 20S β2i subunit polyclonal antibody
BML-PW8150-0100 100 µL

Proteasome 20S β2i subunit polyclonal antibody

Sign In for Pricing
View Details