Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP57, Human (His)

CEP57 is a centrosomal protein that is a potential player in promoting microtubule attachment to centrosomes, possibly by forming a ring-like structure around microtubules. The protein exhibits homodimer and homooligomer formation and interacts with microtubules. CEP57 Protein, Human (GST) is the recombinant human-derived CEP57 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

CEP57 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cep57-protein-human-gst.html

Purity

97.00

Smiles

SKNEESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKR

Molecular Formula

9702 (Gene_ID) Q86XR8 (S118-R226) (Accession)

Molecular Weight

Approximately 14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Phospho-RNA polymerase II CTD repeat YSPTSPS (Ser5) Polyclonal Antibody
TMAB-12271-01 50 μL

Anti-Phospho-RNA polymerase II CTD repeat YSPTSPS (Ser5) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-RNA polymerase II CTD repeat YSPTSPS (Ser5) Polyclonal Antibody
TMAB-12271-02 100 µL

Anti-Phospho-RNA polymerase II CTD repeat YSPTSPS (Ser5) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-RNA polymerase II CTD repeat YSPTSPS (Ser5) Polyclonal Antibody
TMAB-12271-03 200 µL

Anti-Phospho-RNA polymerase II CTD repeat YSPTSPS (Ser5) Polyclonal Antibody

Sign In for Pricing
View Details
C8orf33-set siRNA/shRNA/RNAi Lentivector (Human)
14724091 4x 500 ng

C8orf33-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Anti-ZNF609 Antibody Picoband®, iFluor647 Conjugate
A15674-2-iFluor647 100 µg

Anti-ZNF609 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
LIN28B Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-61215R-APC-Cy5.5 100 µL

LIN28B Recombinant Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details