Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTCF, Human

CTCF protein is a chromatin-binding factor that plays multiple roles in transcriptional regulation and epigenetic control. It binds to DNA at specific sites and acts as a transcriptional repressor by binding to chromatin insulators to prevent undesirable interactions between promoters and neighboring enhancers or silencers. CTCF Protein, Human is the recombinant human-derived CTCF protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

CTCF Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctcf-protein-human.html

Purity

95.00

Smiles

MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMI

Molecular Formula

10664 (Gene_ID) P49711-1 (M1-I154) (Accession)

Molecular Weight

Approximately 38 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Ovary: right
CB501070 1 Block

Frozen Tissue Blocks, Ovary: right

Sign In for Pricing
View Details
USP37 (N-term) Rabbit Polyclonal Antibody
AP54447PU-N 400 µL

USP37 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1-Cyclopentyl-4-nitrosopiperazine-d9
TRC-C213797-2.5MG 2.5 mg

1-Cyclopentyl-4-nitrosopiperazine-d9

Sign In for Pricing
View Details
Cytokeratin-6A Antibody
KC-29452-01 50 μL

Cytokeratin-6A Antibody

Sign In for Pricing
View Details
Cytokeratin-6A Antibody
KC-29452-02 100 µL

Cytokeratin-6A Antibody

Sign In for Pricing
View Details
Cytokeratin-6A Antibody
KC-29452-03 1 mL

Cytokeratin-6A Antibody

Sign In for Pricing
View Details