Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTCF, Human

CTCF protein is a chromatin-binding factor that plays multiple roles in transcriptional regulation and epigenetic control. It binds to DNA at specific sites and acts as a transcriptional repressor by binding to chromatin insulators to prevent undesirable interactions between promoters and neighboring enhancers or silencers. CTCF Protein, Human is the recombinant human-derived CTCF protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

CTCF Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctcf-protein-human.html

Purity

95.00

Smiles

MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMI

Molecular Formula

10664 (Gene_ID) P49711-1 (M1-I154) (Accession)

Molecular Weight

Approximately 38 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-(4-Biphenyl)propionic Acid
TRC-B397855-25G 25 g

3-(4-Biphenyl)propionic Acid

Sign In for Pricing
View Details
Human Resistin Recombinant Rabbit monoclonal Antibody
HA723658 100 µL

Human Resistin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human KLF17 activation kit by CRISPRa
GA115026 1 Kit

Human KLF17 activation kit by CRISPRa

Sign In for Pricing
View Details
ZBTB17 Antibody (Biotin)
KB-3529-01 50 μL

ZBTB17 Antibody (Biotin)

Sign In for Pricing
View Details
ZBTB17 Antibody (Biotin)
KB-3529-02 100 µL

ZBTB17 Antibody (Biotin)

Sign In for Pricing
View Details
ZBTB17 Antibody (Biotin)
KB-3529-03 1 mL

ZBTB17 Antibody (Biotin)

Sign In for Pricing
View Details