LRRC25, Human (HEK293, His)
The LRRC25 protein is an important regulator that inhibits RLR-mediated type I interferon signaling by coordinating the autophagic degradation of RIGI. Its specific interaction with ISG15-related RIGI promotes binding to p62/SQSTM1, leading to selective autophagic RIGI degradation. LRRC25 Protein, Human (HEK293, His) is the recombinant human-derived LRRC25 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
LRRC25 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/lrrc25-protein-human-hek-293-his.html
Smiles
LEPSCTVSSADVDWNAEFSATCLNFSGLSLSLPHNQSLRASNVILLDLSGNGLRELPVTFFAHLQKLEVLNVLRNPLSRVDGALAARCDLDLQADCNCALESWHDIRRDNCSGQKPLLCWDTTSSQHNLSAFLEVSCAPGLASAT
Molecular Formula
126364 (Gene_ID) Q8N386 (L21-T165) (Accession)
Molecular Weight
Approximately 20-40 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items