Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Mouse (HEK293, Fc)

CTLA-4 is a key inhibitory receptor that serves as a major negative regulator of T cell responses in immune regulation. Its unique property is that its affinity to B7 ligands (CD80/CD86) is significantly higher than that of CD28. CTLA-4 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CTLA-4 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-mouse-hek-293-fc.html

Purity

97.00

Smiles

AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Molecular Formula

12477 (Gene_ID) P09793 (A37-D161) (Accession)

Molecular Weight

Approximately 50-60 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Panopsin Antibody
E51A04276 100 µL

Panopsin Antibody

Sign In for Pricing
View Details
GIPC-2 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-8586R-APC-Cy5.5 100 µL

GIPC-2 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Anti-Mouse ANXA1 Polyclonal Antibody
MY216014-01 50 µg

Anti-Mouse ANXA1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Mouse ANXA1 Polyclonal Antibody
MY216014-02 100 µg

Anti-Mouse ANXA1 Polyclonal Antibody

Sign In for Pricing
View Details
Olfr1262 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
32721114 3x 1.0 µg

Olfr1262 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
NFIB rabbit pAb
MBS8598607-01 0.1 mL

NFIB rabbit pAb

Sign In for Pricing
View Details