Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calreticulin/CALR, Mouse (P.pastoris, His)

The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Calreticulin/CALR Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calreticulin-protein-mouse-p-pastoris-his.html

Purity

90.00

Smiles

DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

Molecular Formula

12317 (Gene_ID) P14211 (D18-L416) (Accession)

Molecular Weight

Approximately 48.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amylin (Amylin) Polyclonal Antibody
CAU37279-01 100 µL

Amylin (Amylin) Polyclonal Antibody

Sign In for Pricing
View Details
Amylin (Amylin) Polyclonal Antibody
CAU37279-02 200 µL

Amylin (Amylin) Polyclonal Antibody

Sign In for Pricing
View Details
Amylin (Amylin) Polyclonal Antibody
CAU37279-03 1 mL

Amylin (Amylin) Polyclonal Antibody

Sign In for Pricing
View Details
Keratocan (KERA) (NM_007035) Human Tagged ORF Clone
RG207509 10 µg

Keratocan (KERA) (NM_007035) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Cd81 activation kit by CRISPRa
GA200639 1 Kit

Mouse Cd81 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Iduronate-2-Sulfatase (IDS) CLIA Kit
EKN51045 96 Tests

Human Iduronate-2-Sulfatase (IDS) CLIA Kit

Sign In for Pricing
View Details