Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calreticulin/CALR, Mouse (P.pastoris, His)

The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Calreticulin/CALR Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calreticulin-protein-mouse-p-pastoris-his.html

Purity

90.00

Smiles

DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

Molecular Formula

12317 (Gene_ID) P14211 (D18-L416) (Accession)

Molecular Weight

Approximately 48.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SGK2 (Serum/Glucocorticoid Regulated Kinase 2, H-SGK2, dJ138B7.2) (HRP)
MBS6179494-01 0.1 mL

SGK2 (Serum/Glucocorticoid Regulated Kinase 2, H-SGK2, dJ138B7.2) (HRP)

Sign In for Pricing
View Details
SGK2 (Serum/Glucocorticoid Regulated Kinase 2, H-SGK2, dJ138B7.2) (HRP)
MBS6179494-02 5x 0.1 mL

SGK2 (Serum/Glucocorticoid Regulated Kinase 2, H-SGK2, dJ138B7.2) (HRP)

Sign In for Pricing
View Details
Synuclein, alpha, beta, nitrated
MBS600468-01 0.2 mL

Synuclein, alpha, beta, nitrated

Sign In for Pricing
View Details
Synuclein, alpha, beta, nitrated
MBS600468-02 5x 0.2 mL

Synuclein, alpha, beta, nitrated

Sign In for Pricing
View Details
GARNL3 Antibody - N-terminal region
MBS3200081-01 0.1 mL

GARNL3 Antibody - N-terminal region

Sign In for Pricing
View Details
GARNL3 Antibody - N-terminal region
MBS3200081-02 5x 0.1 mL

GARNL3 Antibody - N-terminal region

Sign In for Pricing
View Details