Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calreticulin/CALR, Mouse (P.pastoris, His)

The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Calreticulin/CALR Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calreticulin-protein-mouse-p-pastoris-his.html

Purity

90.00

Smiles

DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

Molecular Formula

12317 (Gene_ID) P14211 (D18-L416) (Accession)

Molecular Weight

Approximately 48.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGCS2 Knockout HAP1 Polyclonal Cells
ARG22556 1 Million

HMGCS2 Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
Grpel2 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3371503 1.0 µg DNA

Grpel2 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
v-SNARE Vti1p Antibody
C19503-01 50 μL

v-SNARE Vti1p Antibody

Sign In for Pricing
View Details
v-SNARE Vti1p Antibody
C19503-02 100 µL

v-SNARE Vti1p Antibody

Sign In for Pricing
View Details
Recombinant Human linear Ub8 protein
RP10009LQ 100 µg

Recombinant Human linear Ub8 protein

Sign In for Pricing
View Details
Human Zinc finger protein 613, ZNF613 ELISA Kit
MBS9319379-01 48 Well

Human Zinc finger protein 613, ZNF613 ELISA Kit

Sign In for Pricing
View Details