Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calreticulin/CALR, Mouse (P.pastoris, His)

The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Calreticulin/CALR Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calreticulin-protein-mouse-p-pastoris-his.html

Purity

90.00

Smiles

DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

Molecular Formula

12317 (Gene_ID) P14211 (D18-L416) (Accession)

Molecular Weight

Approximately 48.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acid Phosphatase (ACP1) Human qPCR Template Standard (NM_004300)
HK200531 1 Kit

Acid Phosphatase (ACP1) Human qPCR Template Standard (NM_004300)

Sign In for Pricing
View Details
Mouse Monoclonal DMRT2 Antibody (PCRP-DMRT2-1B11)
NBP3-13840-20ug 20 µg

Mouse Monoclonal DMRT2 Antibody (PCRP-DMRT2-1B11)

Sign In for Pricing
View Details
SIKE1 (NM_025073) Human Over-expression Lysate
LY410899 100 µg

SIKE1 (NM_025073) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Lct activation kit by CRISPRa
GA213854 1 Kit

Mouse Lct activation kit by CRISPRa

Sign In for Pricing
View Details
Low-density lipoprotein Receptor-Related protein 11 (LRP11) Human ELISA Kit
E7382 96 Tests

Low-density lipoprotein Receptor-Related protein 11 (LRP11) Human ELISA Kit

Sign In for Pricing
View Details
MSH3 Rabbit Polyclonal Antibody
E53P12468 100 µL

MSH3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details