Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calreticulin/CALR, Mouse (P.pastoris, His)

The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Calreticulin/CALR Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calreticulin-protein-mouse-p-pastoris-his.html

Purity

90.00

Smiles

DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

Molecular Formula

12317 (Gene_ID) P14211 (D18-L416) (Accession)

Molecular Weight

Approximately 48.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYO1B (NM_001130158) Human Tagged ORF Clone Lentiviral Particle
RC226340L3V 200 µL

MYO1B (NM_001130158) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RPS10P22 sgRNA CRISPR Lentivector set (Human)
K2022601 3x 1.0 µg

RPS10P22 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
H3K27me3 Monoclonal Antibody
bs-51019R 50 µg

H3K27me3 Monoclonal Antibody

Sign In for Pricing
View Details
TMEM86B (Transmembrane Protein 86B, MGC30208) (PE)
MBS6451739-01 0.1 mL

TMEM86B (Transmembrane Protein 86B, MGC30208) (PE)

Sign In for Pricing
View Details
TMEM86B (Transmembrane Protein 86B, MGC30208) (PE)
MBS6451739-02 5x 0.1 mL

TMEM86B (Transmembrane Protein 86B, MGC30208) (PE)

Sign In for Pricing
View Details
Sftpa1 (NM_001270647) Rat Untagged Clone
RN216135 10 µg

Sftpa1 (NM_001270647) Rat Untagged Clone

Sign In for Pricing
View Details