Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calreticulin/CALR, Mouse (P.pastoris, His)

The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Calreticulin/CALR Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calreticulin-protein-mouse-p-pastoris-his.html

Purity

90.00

Smiles

DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

Molecular Formula

12317 (Gene_ID) P14211 (D18-L416) (Accession)

Molecular Weight

Approximately 48.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-N-Biotinylaminohexanol
TRC-B394855-100MG 100 mg

6-N-Biotinylaminohexanol

Sign In for Pricing
View Details
C6orf168 sgRNA CRISPR Lentivector (Human) (Target 3)
K0249604 1.0 µg DNA

C6orf168 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
ADAM10 (NM_001110) Human 3' UTR Clone
SC213409 10 µg

ADAM10 (NM_001110) Human 3' UTR Clone

Sign In for Pricing
View Details
CIAP2 (BIRC3) (NM_182962) Human Recombinant Protein
PH36831M5 20 µg

CIAP2 (BIRC3) (NM_182962) Human Recombinant Protein

Sign In for Pricing
View Details
PARP11 Peptide - N-terminal region
MBS3226718-01 0.1 mg

PARP11 Peptide - N-terminal region

Sign In for Pricing
View Details
PARP11 Peptide - N-terminal region
MBS3226718-02 5x 0.1 mg

PARP11 Peptide - N-terminal region

Sign In for Pricing
View Details