Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calreticulin/CALR, Mouse (P.pastoris, His)

The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Calreticulin/CALR Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calreticulin-protein-mouse-p-pastoris-his.html

Purity

90.00

Smiles

DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

Molecular Formula

12317 (Gene_ID) P14211 (D18-L416) (Accession)

Molecular Weight

Approximately 48.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycoplasma Pneumoniae MPN_347 Protein (aa 1-376)
VAng-Lsx04917-50gEcoli 50 µg (E. coli)

Recombinant Mycoplasma Pneumoniae MPN_347 Protein (aa 1-376)

Sign In for Pricing
View Details
SEC23B Recombinant Protein Antigen
NBP1-85732PEP 0.1 mL

SEC23B Recombinant Protein Antigen

Sign In for Pricing
View Details
5-Chloro-2-hydroxyphenylboronic acid
436061-01 100 mg

5-Chloro-2-hydroxyphenylboronic acid

Sign In for Pricing
View Details
5-Chloro-2-hydroxyphenylboronic acid
436061-02 250 mg

5-Chloro-2-hydroxyphenylboronic acid

Sign In for Pricing
View Details
Rabbit anti-Emericella nidulans (strain FGSC A4/38163/CBS 112.46/NRRL 194/M139)(Aspergillus nidulans) penDE Polyclonal Antibody
MBS7152603 Inquire

Rabbit anti-Emericella nidulans (strain FGSC A4/38163/CBS 112.46/NRRL 194/M139)(Aspergillus nidulans) penDE Polyclonal Antibody

Sign In for Pricing
View Details
Porcine DNA Replication Licensing Factor MCM5 (MCM5) ELISA Kit
MBS9353941-01 48 Well

Porcine DNA Replication Licensing Factor MCM5 (MCM5) ELISA Kit

Sign In for Pricing
View Details