Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calreticulin/CALR, Mouse (P.pastoris, His)

The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Calreticulin/CALR Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calreticulin-protein-mouse-p-pastoris-his.html

Purity

90.00

Smiles

DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

Molecular Formula

12317 (Gene_ID) P14211 (D18-L416) (Accession)

Molecular Weight

Approximately 48.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Visceral Adipose Tissue Derived Serine Protease Inhibitor (Vaspin) ELISA Kit
EKN49260 96 Tests

Human Visceral Adipose Tissue Derived Serine Protease Inhibitor (Vaspin) ELISA Kit

Sign In for Pricing
View Details
Recombinant Plasmodium Falciparum Queuine tRNA-ribosyltransferase-like Protein (aa 1-241)
VAng-Wyb6762-50gEcoli 50 µg (E. coli)

Recombinant Plasmodium Falciparum Queuine tRNA-ribosyltransferase-like Protein (aa 1-241)

Sign In for Pricing
View Details
Anti-Ataxin-1 Antibody
56550 1 Each

Anti-Ataxin-1 Antibody

Sign In for Pricing
View Details
Recombinant Ochrobactrum anthropi Thiazole synthase (thiG)
MBS1039225-01 0.02 mg (E-Coli)

Recombinant Ochrobactrum anthropi Thiazole synthase (thiG)

Sign In for Pricing
View Details
Recombinant Ochrobactrum anthropi Thiazole synthase (thiG)
MBS1039225-02 0.1 mg (E-Coli)

Recombinant Ochrobactrum anthropi Thiazole synthase (thiG)

Sign In for Pricing
View Details
Recombinant Ochrobactrum anthropi Thiazole synthase (thiG)
MBS1039225-03 0.02 mg (Yeast)

Recombinant Ochrobactrum anthropi Thiazole synthase (thiG)

Sign In for Pricing
View Details