Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calreticulin/CALR, Mouse (P.pastoris, His)

The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Calreticulin/CALR Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calreticulin-protein-mouse-p-pastoris-his.html

Purity

90.00

Smiles

DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

Molecular Formula

12317 (Gene_ID) P14211 (D18-L416) (Accession)

Molecular Weight

Approximately 48.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FCGR3A (Fc Fragment of IgG, Low Affinity IIIa, Receptor, CD16, FCG3, CD16A, FCGR3, IGFR3, FCR-10, FCRIII, FCGRIII, FCRIIIA) (Biotin)
MBS6417082-01 0.1 mL

FCGR3A (Fc Fragment of IgG, Low Affinity IIIa, Receptor, CD16, FCG3, CD16A, FCGR3, IGFR3, FCR-10, FCRIII, FCGRIII, FCRIIIA) (Biotin)

Sign In for Pricing
View Details
FCGR3A (Fc Fragment of IgG, Low Affinity IIIa, Receptor, CD16, FCG3, CD16A, FCGR3, IGFR3, FCR-10, FCRIII, FCGRIII, FCRIIIA) (Biotin)
MBS6417082-02 5x 0.1 mL

FCGR3A (Fc Fragment of IgG, Low Affinity IIIa, Receptor, CD16, FCG3, CD16A, FCGR3, IGFR3, FCR-10, FCRIII, FCGRIII, FCRIIIA) (Biotin)

Sign In for Pricing
View Details
LGR6 (NM_001017403) Human Over-expression Lysate
LS059352-20ug 20 µg

LGR6 (NM_001017403) Human Over-expression Lysate

Sign In for Pricing
View Details
MMP8 (Matrix Metalloproteinase 8, HNC, CLG1, MMP-8, PMNL-CL) (AP)
MBS6427002-01 0.1 mL

MMP8 (Matrix Metalloproteinase 8, HNC, CLG1, MMP-8, PMNL-CL) (AP)

Sign In for Pricing
View Details
MMP8 (Matrix Metalloproteinase 8, HNC, CLG1, MMP-8, PMNL-CL) (AP)
MBS6427002-02 5x 0.1 mL

MMP8 (Matrix Metalloproteinase 8, HNC, CLG1, MMP-8, PMNL-CL) (AP)

Sign In for Pricing
View Details
Parp4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4858206 1.0 µg DNA

Parp4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details