Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calreticulin/CALR, Mouse (P.pastoris, His)

The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Calreticulin/CALR Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calreticulin-protein-mouse-p-pastoris-his.html

Purity

90.00

Smiles

DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

Molecular Formula

12317 (Gene_ID) P14211 (D18-L416) (Accession)

Molecular Weight

Approximately 48.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pde6c Mouse Gene Knockout Kit (CRISPR)
KN513022 1 Kit

Pde6c Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PI 3 Kinase reguLatory subunit 4 (PIK3R4) (NM_014602) Human Tagged ORF Clone Lentiviral Particle
RC210308L1V 200 µL

PI 3 Kinase reguLatory subunit 4 (PIK3R4) (NM_014602) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral human ABCA8 shRNA (UAS) - Lentiviral human ABCA8 shRNA (UAS, GFP) plasmid
GTR15348529 1 Vial

Lentiviral human ABCA8 shRNA (UAS) - Lentiviral human ABCA8 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Vegfa (NM_001110334) Rat Tagged ORF Clone Lentiviral Particle
RR200264L4V 200 µL

Vegfa (NM_001110334) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Glycoprotein A33 (GPA33) Protein
abx692063 50 µg

Mouse Glycoprotein A33 (GPA33) Protein

Sign In for Pricing
View Details
Lentiviral mouse Hmgcr shRNA (UAS) - Lentiviral mouse Hmgcr shRNA (UAS, GFP) plasmid
GTR15152722 1 Vial

Lentiviral mouse Hmgcr shRNA (UAS) - Lentiviral mouse Hmgcr shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details