Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calreticulin/CALR, Mouse (P.pastoris, His)

The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Calreticulin/CALR Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calreticulin-protein-mouse-p-pastoris-his.html

Purity

90.00

Smiles

DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

Molecular Formula

12317 (Gene_ID) P14211 (D18-L416) (Accession)

Molecular Weight

Approximately 48.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM95 3'UTR Lenti-reporter-Luc Vector
47115081 1.0 µg

TMEM95 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Recombinant Klebsiella Pneumoniae nifX Protein (aa 1-156)
VAng-Cr5160-1mgEcoli 1 mg (E. coli)

Recombinant Klebsiella Pneumoniae nifX Protein (aa 1-156)

Sign In for Pricing
View Details
Phospho-BCL2 (T74) Antibody
MBS7120434-01 0.05 mg

Phospho-BCL2 (T74) Antibody

Sign In for Pricing
View Details
Phospho-BCL2 (T74) Antibody
MBS7120434-02 0.1 mg

Phospho-BCL2 (T74) Antibody

Sign In for Pricing
View Details
Phospho-BCL2 (T74) Antibody
MBS7120434-03 5x 0.1 mg

Phospho-BCL2 (T74) Antibody

Sign In for Pricing
View Details
SPACA5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2263805 3x 1.0 µg

SPACA5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details