Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calreticulin/CALR, Mouse (P.pastoris, His)

The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Calreticulin/CALR Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calreticulin-protein-mouse-p-pastoris-his.html

Purity

90.00

Smiles

DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

Molecular Formula

12317 (Gene_ID) P14211 (D18-L416) (Accession)

Molecular Weight

Approximately 48.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ebola virus
397636 100 µg

Ebola virus

Sign In for Pricing
View Details
TRNAK25 AAV siRNA Pooled Vector
68582161 1.0 µg

TRNAK25 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
SKF-96365 hydrochloride 10mM * 1mL in DMSO
A16706-10mM-D 10 mM x 1mL in DMSO

SKF-96365 hydrochloride 10mM * 1mL in DMSO

Sign In for Pricing
View Details
Recombinant Pseudomonas entomophila Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)
MBS1360438-01 0.02 mg (E-Coli)

Recombinant Pseudomonas entomophila Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)

Sign In for Pricing
View Details
Recombinant Pseudomonas entomophila Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)
MBS1360438-02 0.02 mg (Yeast)

Recombinant Pseudomonas entomophila Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)

Sign In for Pricing
View Details
Recombinant Pseudomonas entomophila Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)
MBS1360438-03 0.1 mg (E-Coli)

Recombinant Pseudomonas entomophila Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)

Sign In for Pricing
View Details