Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calreticulin/CALR, Mouse (P.pastoris, His)

The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Calreticulin/CALR Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calreticulin-protein-mouse-p-pastoris-his.html

Purity

90.00

Smiles

DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

Molecular Formula

12317 (Gene_ID) P14211 (D18-L416) (Accession)

Molecular Weight

Approximately 48.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human cryptosporidium (Cry) antibody ELISA Kit
MBS2600132-01 48 Well

Human cryptosporidium (Cry) antibody ELISA Kit

Sign In for Pricing
View Details
Human cryptosporidium (Cry) antibody ELISA Kit
MBS2600132-02 96 Well

Human cryptosporidium (Cry) antibody ELISA Kit

Sign In for Pricing
View Details
Human cryptosporidium (Cry) antibody ELISA Kit
MBS2600132-03 5x 96 Well

Human cryptosporidium (Cry) antibody ELISA Kit

Sign In for Pricing
View Details
Human cryptosporidium (Cry) antibody ELISA Kit
MBS2600132-04 10x 96 Well

Human cryptosporidium (Cry) antibody ELISA Kit

Sign In for Pricing
View Details
MrgB3 siRNA (m)
sc-149564 10 µM

MrgB3 siRNA (m)

Sign In for Pricing
View Details
RPL17P21 3'UTR Lenti-reporter-Luc Vector
40884081 1.0 µg

RPL17P21 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details