Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis CD276 molecule (CD276), partial (Active)

Product Specifications

Abbreviation

Recombinant Cynomolgus monkey CD276 protein, partial (Active)

Gene Name

CD276

UniProt

A0A7N9CYV2

Expression Region

29-465aa

Organism

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Target Sequence

LEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFLDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSITITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFLDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPE

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CD276 at 2 μg/mL can bind Anti-CD276 recombinant antibody (CSB-RA733578MA1HU) . The EC50 is 4.299-5.373 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

48.4 kDa

References & Citations

Warren W., Wilson R.K. Submitted to EMBL/GenBank/DDBJ databases (MAR-2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KLHDC1 Knockout HEK293T cell line
GTR15409310 1 Vial

Human KLHDC1 Knockout HEK293T cell line

Sign In for Pricing
View Details
SPACA4 Rabbit pAb, Pacific Blue conjugated
orb2851329 100 µL

SPACA4 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
CX3CR1 (NT) (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) (APC) discontinued
C8300-01B-APC 100 µL

CX3CR1 (NT) (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) (APC) discontinued

Sign In for Pricing
View Details
ZNF711 siRNA (Human)
CRH5161-01 15 nmol

ZNF711 siRNA (Human)

Sign In for Pricing
View Details
ZNF711 siRNA (Human)
CRH5161-02 30 nmol

ZNF711 siRNA (Human)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Bcl2 Modifying Factor (BMF)
MBS2064957-01 0.1 mL

APC-Linked Polyclonal Antibody to Bcl2 Modifying Factor (BMF)

Sign In for Pricing
View Details