Question 1

What is the catalog number for SPRR1A Polyclonal Antibody?

Accepted Answer

The catalog number for SPRR1A Polyclonal Antibody is MBS9433202.

Question 2

What sizes are available for SPRR1A Polyclonal Antibody?

Accepted Answer

SPRR1A Polyclonal Antibody is available in the following size(s): 0.05 mL, 0.1 mL, 5x 0.1 mL.

Question 3

How many pack sizes does SPRR1A Polyclonal Antibody come in?

Accepted Answer

SPRR1A Polyclonal Antibody is available in 3 different pack sizes.

Question 4

Is SPRR1A Polyclonal Antibody in stock?

Accepted Answer

SPRR1A Polyclonal Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Question 5

What is the recommended storage temperature after reconstitution?

Accepted Answer

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Question 6

Can this product be used in multiplex assays?

Accepted Answer

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

Question 7

What happens if this product doesn’t perform as expected in my experiment?

Accepted Answer

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

SPRR1A Polyclonal Antibody

Product Specifications

CAS Number

Gene Name

NCBI Gene ID

Reactivity

Storage Conditions

Other Gene Names

Short Name

Other Product Names

NCBI GI Number

NCBI Accession Number

Uniprot Accession Number

Available Sizes

Frequently Asked Questions

Explore Other Products

Goat anti-ADH7 Antibody

Goat anti-ADH7 Antibody

MMP1 (Matrix Metalloproteinase 1, CLG, CLGN) (AP)

MMP1 (Matrix Metalloproteinase 1, CLG, CLGN) (AP)

Rabbit Monoclonal IL-13R alpha 1 Antibody (26) [DyLight 755]

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW