Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Glucagon (Gcg), partial

Product Specifications

Product Name Alternative

GRPP; OXM; OXY; GLP-1;7-37; GLP-17-37;7-36; GLP-17-36; GLP-2

Abbreviation

Recombinant Mouse Gcg protein, partial

Gene Name

Gcg

UniProt

P55095

Expression Region

21-89aa

Organism

Mus musculus (Mouse)

Target Sequence

HALQDTEENPRSFPASQTEAHEDPDEMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Metabolism

Relevance

Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes. ; [Glucagon-like peptide 1]: Potent stimulator of glucose-dependent insulin release. Also stimulates insulin release in response to IL6. Plays important roles on gastric motility and the suppression of plasma glucagon levels. May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues, independent of the actions of insulin. Has growth-promoting activities on intestinal epithelium. May also regulate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin secretion. Increases islet mass through stimulation of islet neogenesis and pancreatic beta cell proliferation. Inhibits beta cell apoptosis (Probable) . ; [Glucagon-like peptide 2]: Stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability. ; [Oxyntomodulin]: Significantly reduces food intake. Inhibits gastric emptying in humans. Suppression of gastric emptying may lead to increased gastric distension, which may contribute to satiety by causing a sensation of fullness. ; [Glicentin]: May modulate gastric acid secretion and the gastro-pyloro-duodenal activity. May play an important role in intestinal mucosal growth in the early period of life.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

9.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin B (CTSB) (NM_001908) Human Over-expression Lysate
LY419666 100 µg

Cathepsin B (CTSB) (NM_001908) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Skin
CS714760 5x 5 µm

Tissue FFPE Sections, Skin

Sign In for Pricing
View Details
HGD Recombinant Rabbit Monoclonal Antibody [JE58-85]
HA722565 100 µL

HGD Recombinant Rabbit Monoclonal Antibody [JE58-85]

Sign In for Pricing
View Details
Maltose Microplate Assay Kit
RDSM235 100 Assays

Maltose Microplate Assay Kit

Sign In for Pricing
View Details
SLC12A1 (NM_000338) Human Over-expression Lysate
LY424782 100 µg

SLC12A1 (NM_000338) Human Over-expression Lysate

Sign In for Pricing
View Details
IL3RB (CSF2RB) Mouse Monoclonal Antibody [Clone ID: OTI2B10]
CF807872 100 µg

IL3RB (CSF2RB) Mouse Monoclonal Antibody [Clone ID: OTI2B10]

Sign In for Pricing
View Details