MCP-3/CCL7, Rat
MCP-3/CCL7 Protein, Rat is a CC chemokine and elicitor that binds to CCR1, CCR2 and CCR3 to mediate antiviral, antibacterial, antitumor and other immune responses. MCP-3/CCL7 Protein, Rat is a recombinant rat MCP-3/CCL7 protein expressed by E.coilMCP-3/CCL7 (Q24-P97) [1].
Product Specifications
Product Name Alternative
MCP-3/CCL7 Protein, Rat, Rat, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mcp-3-ccl7-protein-rat.html
Purity
95.0
Smiles
QPDGTNSSTCCYVKKQKIPKRNLKSYRKITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTSTPKP
Molecular Formula
287561 (Gene_ID) Q9QXY8 (Q24-P97) (Accession)
Molecular Weight
Approximately 8.5 kDa
References & Citations
[1]G Opdenakker, et al. The human MCP-3 gene (SCYA7) : cloning, sequence analysis, and assignment to the C-C chemokine gene cluster on chromosome 17q11.2-q12. Genomics. 1994 May 15;21 (2) :403-8.|[2]F Fioretti, et al. Reduced tumorigenicity and augmented leukocyte infiltration after monocyte chemotactic protein-3 (MCP-3) gene transfer: perivascular accumulation of dendritic cells in peritumoral tissue and neutrophil recruitment within the tumor. J Immunol. 1998 Jul 1;161 (1) :342-6.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal ErbB2/Her2 Antibody (HRB2/718) [PE]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
NBP2-34643PE 0.1 mL
Mouse Monoclonal ErbB2/Her2 Antibody (HRB2/718) [PE]
Sign In for Pricing
View Details MBS2506289-01 24 Tests
Porcine PRF1 (Perforin 1/Pore-Forming Protein) ELISA Kit
Sign In for Pricing
View Details