Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRADC1, Human (HEK293, His)

PRADC1 Protein, Human (HEK293, His) is a recombinant human protease-associated domain-containing 1 (PRADC1) produced in HEK293 cells, with His tag. PRADC1 is a metabolic-responsive secretory protein that modulates physical activity and adiposity[1].

Product Specifications

Product Name Alternative

PRADC1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pradc1-protein-human-hek293-his.html

Smiles

HGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFWHHHHHH

Molecular Formula

84279 (Gene_ID) Q9BSG0 (H22-W188) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Susana Rodriguez, et al. PRADC1: a novel metabolic-responsive secretory protein that modulates physical activity and adiposity. FASEB J. 2019 Dec; 33 (12) : 14748-14759.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cat Guanine Nucleotide-Binding Protein Subunit Alpha-16 (GNA16) ELISA Kit
MBS9922893 Inquire

Cat Guanine Nucleotide-Binding Protein Subunit Alpha-16 (GNA16) ELISA Kit

Ask
View Details
AKT3 Polyclonal Antibody
ANT-10159-100ug 100 µg

AKT3 Polyclonal Antibody

Ask
View Details
HCG_2039146, ID (SHISA7, Protein shisa-7, Protein shisa-6-like) (Azide free) (HRP) discontinued
036464-HRP 200 µL

HCG_2039146, ID (SHISA7, Protein shisa-7, Protein shisa-6-like) (Azide free) (HRP) discontinued

Ask
View Details
METRN (NM_024042) Human Over-expression Lysate
LS079006-100ug 100 µg

METRN (NM_024042) Human Over-expression Lysate

Ask
View Details
Troponin I (Cardiac) Recombinant 96%
GWB-5E71E8 0.1 mg

Troponin I (Cardiac) Recombinant 96%

Ask
View Details