PRADC1, Human (HEK293, His)
PRADC1 Protein, Human (HEK293, His) is a recombinant human protease-associated domain-containing 1 (PRADC1) produced in HEK293 cells, with His tag. PRADC1 is a metabolic-responsive secretory protein that modulates physical activity and adiposity[1].
Product Specifications
Product Name Alternative
PRADC1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pradc1-protein-human-hek293-his.html
Smiles
HGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFWHHHHHH
Molecular Formula
84279 (Gene_ID) Q9BSG0 (H22-W188) (Accession)
Molecular Weight
Approximately 28 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Susana Rodriguez, et al. PRADC1: a novel metabolic-responsive secretory protein that modulates physical activity and adiposity. FASEB J. 2019 Dec; 33 (12) : 14748-14759.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items