Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRADC1, Human (HEK293, His)

PRADC1 Protein, Human (HEK293, His) is a recombinant human protease-associated domain-containing 1 (PRADC1) produced in HEK293 cells, with His tag. PRADC1 is a metabolic-responsive secretory protein that modulates physical activity and adiposity[1].

Product Specifications

Product Name Alternative

PRADC1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pradc1-protein-human-hek293-his.html

Smiles

HGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFWHHHHHH

Molecular Formula

84279 (Gene_ID) Q9BSG0 (H22-W188) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Susana Rodriguez, et al. PRADC1: a novel metabolic-responsive secretory protein that modulates physical activity and adiposity. FASEB J. 2019 Dec; 33 (12) : 14748-14759.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human High affinity immunoglobulin epsilon receptor subunit beta (MS4A2)-VLPs
MBS9018936-01 0.02 mg (Mammalian-Cell)

Recombinant Human High affinity immunoglobulin epsilon receptor subunit beta (MS4A2)-VLPs

Ask
View Details
Recombinant Human High affinity immunoglobulin epsilon receptor subunit beta (MS4A2)-VLPs
MBS9018936-02 0.1 mg (Mammalian-Cell)

Recombinant Human High affinity immunoglobulin epsilon receptor subunit beta (MS4A2)-VLPs

Ask
View Details
Recombinant Human High affinity immunoglobulin epsilon receptor subunit beta (MS4A2)-VLPs
MBS9018936-03 0.5 mg (Mammalian-Cell)

Recombinant Human High affinity immunoglobulin epsilon receptor subunit beta (MS4A2)-VLPs

Ask
View Details
Rheostats, Sliding Contact, Open Type, Single Tube
1091080/8B 1 Each

Rheostats, Sliding Contact, Open Type, Single Tube

Ask
View Details
Recombinant Human CACNB4 Protein, N-His
MBS1587101-01 0.1 mg

Recombinant Human CACNB4 Protein, N-His

Ask
View Details
Recombinant Human CACNB4 Protein, N-His
MBS1587101-02 1 mg

Recombinant Human CACNB4 Protein, N-His

Ask
View Details