PRADC1, Human (HEK293, His)
PRADC1 Protein, Human (HEK293, His) is a recombinant human protease-associated domain-containing 1 (PRADC1) produced in HEK293 cells, with His tag. PRADC1 is a metabolic-responsive secretory protein that modulates physical activity and adiposity[1].
Product Specifications
Product Name Alternative
PRADC1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pradc1-protein-human-hek293-his.html
Smiles
HGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFWHHHHHH
Molecular Formula
84279 (Gene_ID) Q9BSG0 (H22-W188) (Accession)
Molecular Weight
Approximately 28 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Susana Rodriguez, et al. PRADC1: a novel metabolic-responsive secretory protein that modulates physical activity and adiposity. FASEB J. 2019 Dec; 33 (12) : 14748-14759.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470257-500 1x 500 µL
Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940806-500 1x 500 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880693-100 1x 100 µL
CD56 / NCAM (123C3.D5 + 123A8), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881555-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (EGP40/1555R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400716-500 1x 500 µL
Thymidylate Synthase (TS106 + TMS715), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details