Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT2, Human (His)

The NUDT2 protein has a dual enzymatic role as a catalyst for the asymmetric hydrolysis of diadenosine 5',5'''-P1, P4-tetraphosphate (Ap4A) to generate AMP and ATP. This activity highlights its involvement in nucleotide metabolism and the regulation of cellular purine nucleotide pools. NUDT2 Protein, Human (His) is the recombinant human-derived NUDT2 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

NUDT2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nudt2-protein-human-his.html

Purity

97.50

Smiles

MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA

Molecular Formula

318 (Gene_ID) P50583 (M1-A147) (Accession)

Molecular Weight

Approximately 18.3-19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLR2A Recombinant Rabbit monoclonal Antibody
HA723983 100 µL

POLR2A Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: right
CR560716 5 µg

Tissue Total RNA, Ovary: right

Sign In for Pricing
View Details
Recombinant Cynomolgus CSF1R/CD115 Protein (His Tag)
PKSQ050034-01 10 µg

Recombinant Cynomolgus CSF1R/CD115 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Cynomolgus CSF1R/CD115 Protein (His Tag)
PKSQ050034-02 50 µg

Recombinant Cynomolgus CSF1R/CD115 Protein (His Tag)

Sign In for Pricing
View Details
Rb (RB1) Human Gene Knockout Kit (CRISPR)
KN206933LP 1 Kit

Rb (RB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ammonium Cerium(IV) Nitrate
TRC-A633930-25G 25 g

Ammonium Cerium(IV) Nitrate

Sign In for Pricing
View Details