Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT2, Human (His)

The NUDT2 protein has a dual enzymatic role as a catalyst for the asymmetric hydrolysis of diadenosine 5',5'''-P1, P4-tetraphosphate (Ap4A) to generate AMP and ATP. This activity highlights its involvement in nucleotide metabolism and the regulation of cellular purine nucleotide pools. NUDT2 Protein, Human (His) is the recombinant human-derived NUDT2 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

NUDT2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nudt2-protein-human-his.html

Purity

97.50

Smiles

MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA

Molecular Formula

318 (Gene_ID) P50583 (M1-A147) (Accession)

Molecular Weight

Approximately 18.3-19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Acetyl-2-naphthylamine
TRC-A186950-1G 1 g

N-Acetyl-2-naphthylamine

Sign In for Pricing
View Details
DCAF4 Polyclonal Antibody
E-AB-90980-01 60 µL

DCAF4 Polyclonal Antibody

Sign In for Pricing
View Details
DCAF4 Polyclonal Antibody
E-AB-90980-02 120 µL

DCAF4 Polyclonal Antibody

Sign In for Pricing
View Details
DCAF4 Polyclonal Antibody
E-AB-90980-03 200 µL

DCAF4 Polyclonal Antibody

Sign In for Pricing
View Details
Berberine Chloride Hydrate
TRC-B318150-25G 25 g

Berberine Chloride Hydrate

Sign In for Pricing
View Details
Human CD21 ELISA Kit, 1 x 48-well (pre-coated)
EA101202 1x 48 Well (Pre-Coated)

Human CD21 ELISA Kit, 1 x 48-well (pre-coated)

Sign In for Pricing
View Details