Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT2, Human (His)

The NUDT2 protein has a dual enzymatic role as a catalyst for the asymmetric hydrolysis of diadenosine 5',5'''-P1, P4-tetraphosphate (Ap4A) to generate AMP and ATP. This activity highlights its involvement in nucleotide metabolism and the regulation of cellular purine nucleotide pools. NUDT2 Protein, Human (His) is the recombinant human-derived NUDT2 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

NUDT2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nudt2-protein-human-his.html

Purity

97.50

Smiles

MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA

Molecular Formula

318 (Gene_ID) P50583 (M1-A147) (Accession)

Molecular Weight

Approximately 18.3-19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurocan Recombinant Rabbit Monoclonal Antibody [JE54-15]
ET7110-59 100 µL

Neurocan Recombinant Rabbit Monoclonal Antibody [JE54-15]

Sign In for Pricing
View Details
C20orf151 (RBBP8NL) (NM_080833) Human Recombinant Protein
TP312450L 1 mg

C20orf151 (RBBP8NL) (NM_080833) Human Recombinant Protein

Sign In for Pricing
View Details
OptiWell™ Deep Well Plates
D3096-35 50 Units/Case

OptiWell™ Deep Well Plates

Sign In for Pricing
View Details
MitoLite™ Blue FX490
22674-AAT 500 Tests

MitoLite™ Blue FX490

Sign In for Pricing
View Details
MSF (SEPT9) (NM_001113495) Human Over-expression Lysate
LY426421 100 µg

MSF (SEPT9) (NM_001113495) Human Over-expression Lysate

Sign In for Pricing
View Details
LINC01587 Human Gene Knockout Kit (CRISPR)
KN424574 1 Kit

LINC01587 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details