Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT2, Human (His)

The NUDT2 protein has a dual enzymatic role as a catalyst for the asymmetric hydrolysis of diadenosine 5',5'''-P1, P4-tetraphosphate (Ap4A) to generate AMP and ATP. This activity highlights its involvement in nucleotide metabolism and the regulation of cellular purine nucleotide pools. NUDT2 Protein, Human (His) is the recombinant human-derived NUDT2 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

NUDT2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nudt2-protein-human-his.html

Purity

97.50

Smiles

MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA

Molecular Formula

318 (Gene_ID) P50583 (M1-A147) (Accession)

Molecular Weight

Approximately 18.3-19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LDHD Rabbit Polyclonal Antibody
TA377984 100 µL

LDHD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Fmnl2 activation kit by CRISPRa
GA208827 1 Kit

Mouse Fmnl2 activation kit by CRISPRa

Sign In for Pricing
View Details
NTA Azide
12605-AAT 1 mg

NTA Azide

Sign In for Pricing
View Details
UBE2V1 Polyclonal Antibody
E-AB-52433-01 20 µL

UBE2V1 Polyclonal Antibody

Sign In for Pricing
View Details
UBE2V1 Polyclonal Antibody
E-AB-52433-02 60 µL

UBE2V1 Polyclonal Antibody

Sign In for Pricing
View Details
UBE2V1 Polyclonal Antibody
E-AB-52433-03 120 µL

UBE2V1 Polyclonal Antibody

Sign In for Pricing
View Details