Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT2, Human (His)

The NUDT2 protein has a dual enzymatic role as a catalyst for the asymmetric hydrolysis of diadenosine 5',5'''-P1, P4-tetraphosphate (Ap4A) to generate AMP and ATP. This activity highlights its involvement in nucleotide metabolism and the regulation of cellular purine nucleotide pools. NUDT2 Protein, Human (His) is the recombinant human-derived NUDT2 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

NUDT2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nudt2-protein-human-his.html

Purity

97.50

Smiles

MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA

Molecular Formula

318 (Gene_ID) P50583 (M1-A147) (Accession)

Molecular Weight

Approximately 18.3-19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGF (Vascular Endothelial Growth Factor) (VG1), CF488A conjugate, 0.1mg/mL
BNC881686-500 1x 500 µL

VEGF (Vascular Endothelial Growth Factor) (VG1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VNN3 (NM_018399) Human Over-expression Lysate
LC402675 20 µg

VNN3 (NM_018399) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse C1qtnf1 activation kit by CRISPRa
GA206079 1 Kit

Mouse C1qtnf1 activation kit by CRISPRa

Sign In for Pricing
View Details
OR4D10 Human Gene Knockout Kit (CRISPR)
KN424935 1 Kit

OR4D10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EXOSC8 Antibody
KC-47424-01 50 μL

EXOSC8 Antibody

Sign In for Pricing
View Details
EXOSC8 Antibody
KC-47424-02 100 µL

EXOSC8 Antibody

Sign In for Pricing
View Details