NUDT2, Human (His)
The NUDT2 protein has a dual enzymatic role as a catalyst for the asymmetric hydrolysis of diadenosine 5',5'''-P1, P4-tetraphosphate (Ap4A) to generate AMP and ATP. This activity highlights its involvement in nucleotide metabolism and the regulation of cellular purine nucleotide pools. NUDT2 Protein, Human (His) is the recombinant human-derived NUDT2 protein, expressed by E. coli , with N-His labeled tag.
Product Specifications
Product Name Alternative
NUDT2 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/nudt2-protein-human-his.html
Purity
97.50
Smiles
MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
Molecular Formula
318 (Gene_ID) P50583 (M1-A147) (Accession)
Molecular Weight
Approximately 18.3-19 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Munc18 1 (STXBP1) (NM_001032221) Human Recombinant Protein
HIF1A, NT (HIF1A, BHLHE78, MOP1, PASD8, Hypoxia-inducible factor 1-alpha, ARNT-interacting protein, Basic-helix-loop-helix-PAS protein MOP1, Class E basic helix-loop-helix protein 78, Member of PAS protein 1, PAS domain-containing protein 8) (AP) discontinued
Human Tctex1 domain-containing protein 4, TCTEX1D4 ELISA Kit