Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEC/CCL28, Mouse

MEC/CCL28 Protein, Mouse is a CC chemokine that is present in almost all mucosal tissues and acts as a unifying immunostimulant on mucosal surfaces. CCL28 can bind to CCR3 and CCR10 to mediate immune responses, viral infections, cancer, and antimicrobial effects. MEC/CCL28 Protein, Mouse is a recombinant mouse MEC/CCL28 (S20-R130) protein expressed by E. coli[1][2].

Product Specifications

Product Name Alternative

MEC/CCL28 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mec-ccl28-protein-mouse.html

Purity

99.00

Smiles

SEAILPMASSCCTEVSHHVSGRLLERVSSCSIQRADGDCDLAAVILHVKRRRICISPHNRTLKQWMRASEVKKNGRENVCSGKKQPSRKDRKGHTTRKHRTRGTHRHEASR

Molecular Formula

56838 (Gene_ID) Q9JIL2 (S20-R130) (Accession)

Molecular Weight

Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Meurens F, et al. Expression of mucosal chemokines TECK/CCL25 and MEC/CCL28 during fetal development of the ovine mucosal immune system. Immunology. 2007 Apr;120 (4) :544-55.|[2]Hiroyuki Ogawa, et al. Regulated production of the chemokine CCL28 in human colon epithelium. Am J Physiol Gastrointest Liver Physiol. 2004 Nov;287 (5) :G1062-9.|[3]Teena Mohan, et al. CCL28 chemokine: An anchoring point bridging innate and adaptive immunity. Int Immunopharmacol. 2017 Oct;51:165-170.|[4]Nicolas Cuburu, et al. Sublingual immunization with nonreplicating antigens induces antibody-forming cells and cytotoxic T cells in the female genital tract mucosa and protects against genital papillomavirus infection. J Immunol. 2009 Dec 15;183 (12) :7851-9.|[5]Eleonora Castelletti, et al. The mucosae-associated epithelial chemokine (MEC/CCL28) modulates immunity in HIV infection. PLoS One. 2007 Oct 3;2 (10) :e969.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8-Nonadecanone
TRC-N649210-25MG 25 mg

8-Nonadecanone

Sign In for Pricing
View Details
Ent Florfenicol amine-D3
TRC-E473890-10MG 10 mg

Ent Florfenicol amine-D3

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB511210 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
BRUNOL6 (CELF6) (NM_001172684) Human Over-expression Lysate
LC433113 20 µg

BRUNOL6 (CELF6) (NM_001172684) Human Over-expression Lysate

Sign In for Pricing
View Details
PTEN (N-term) Rabbit Polyclonal Antibody
AP15248PU-N 400 µL

PTEN (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cdadc1 Mouse Gene Knockout Kit (CRISPR)
KN502956 1 Kit

Cdadc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details