Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21, Mouse (His)

IL-21 is a cytokine with immunomodulatory capabilities that orchestrates the transition from innate to adaptive immunity. It induces the production of IgG (1) and IgG (3) by B cells, thereby forming a humoral immune response. IL-21 Protein, Mouse (His) is the recombinant mouse-derived IL-21 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-21 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21-protein-mouse-his.html

Purity

98.0

Smiles

PDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS

Molecular Formula

60505 (Gene_ID) Q9ES17 (P25-S146) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Hexb (Beta-hexosaminidase subunit beta) ELISA Kit
ER20004 96 Tests

Rat Hexb (Beta-hexosaminidase subunit beta) ELISA Kit

Sign In for Pricing
View Details
2'OMe-ATP
NU-1184S 50 μL

2'OMe-ATP

Sign In for Pricing
View Details
Mouse Zinc finger and SCAN domain-containing protein 12 (ZSCAN12) ELISA Kit
MBS281802-01 48 Tests

Mouse Zinc finger and SCAN domain-containing protein 12 (ZSCAN12) ELISA Kit

Sign In for Pricing
View Details
Mouse Zinc finger and SCAN domain-containing protein 12 (ZSCAN12) ELISA Kit
MBS281802-02 96 Tests

Mouse Zinc finger and SCAN domain-containing protein 12 (ZSCAN12) ELISA Kit

Sign In for Pricing
View Details
Mouse Zinc finger and SCAN domain-containing protein 12 (ZSCAN12) ELISA Kit
MBS281802-03 5x 96 Tests

Mouse Zinc finger and SCAN domain-containing protein 12 (ZSCAN12) ELISA Kit

Sign In for Pricing
View Details
Mouse Zinc finger and SCAN domain-containing protein 12 (ZSCAN12) ELISA Kit
MBS281802-04 10x 96 Tests

Mouse Zinc finger and SCAN domain-containing protein 12 (ZSCAN12) ELISA Kit

Sign In for Pricing
View Details