Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21, Mouse (His)

IL-21 is a cytokine with immunomodulatory capabilities that orchestrates the transition from innate to adaptive immunity. It induces the production of IgG (1) and IgG (3) by B cells, thereby forming a humoral immune response. IL-21 Protein, Mouse (His) is the recombinant mouse-derived IL-21 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-21 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21-protein-mouse-his.html

Purity

98.0

Smiles

PDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS

Molecular Formula

60505 (Gene_ID) Q9ES17 (P25-S146) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wrnip1 AAV siRNA Pooled Vector
50467166 1.0 µg

Wrnip1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
PRLR Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-61624R-BF680-01 20 µL

PRLR Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
PRLR Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-61624R-BF680-02 100 µL

PRLR Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal C19orf44 Antibody [PerCP]
NBP2-98139PCP 0.1 mL

Rabbit Polyclonal C19orf44 Antibody [PerCP]

Sign In for Pricing
View Details
HAMP (Hepcidin, Liver-expressed Antimicrobial Peptide 1, LEAP-1, Putative Liver Tumor Regressor, PLTR, HEPC, LEAP1, UNQ487/PRO1003) (PE)
127716-PE 100 µL

HAMP (Hepcidin, Liver-expressed Antimicrobial Peptide 1, LEAP-1, Putative Liver Tumor Regressor, PLTR, HEPC, LEAP1, UNQ487/PRO1003) (PE)

Sign In for Pricing
View Details
Human RBL1 Pre-designed siRNA Set B
SI013487B 1 Each

Human RBL1 Pre-designed siRNA Set B

Sign In for Pricing
View Details