Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human IL-12 receptor beta component (IL12RB1), partial

Product Specifications

Product Name Alternative

IL-12 receptor subunit beta-1; IL-12R subunit beta-1; IL-12R-beta-1; IL-12RB1; IL-12 receptor beta component; CD antigen CD212

Abbreviation

Recombinant Human IL12RB1 protein, partial

Gene Name

IL12RB1

UniProt

P42701

Expression Region

25-239aa

Organism

Homo sapiens (Human)

Target Sequence

RTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQP

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Immunology

Relevance

Functions as an interleukin receptor which binds interleukin-12 with low affinity and is involved in IL12 transduction. Associated with IL12RB2 it forms a functional, high affinity receptor for IL12. Associates also with IL23R to form the interleukin-23 receptor which functions in IL23 signal transduction probably through activation of the Jak-Stat signaling cascade.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycodeoxycholic Acid
TRC-G641403-50MG 50 mg

Glycodeoxycholic Acid

Sign In for Pricing
View Details
Dibutyltin(IV) Oxide
TRC-D429560-1G 1 g

Dibutyltin(IV) Oxide

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PAb1801), CF640R conjugate, 0.1mg/mL
BNC401916-500 1x 500 µL

P53 Tumor Suppressor Protein (PAb1801), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Oxalic Acid Potassium Salt Dihydrate
TRC-O845125-5G 5 g

Oxalic Acid Potassium Salt Dihydrate

Sign In for Pricing
View Details
Caspase 1 (CASP1) Mouse Monoclonal Antibody [Clone ID: OTI12A9]
CF815737 100 µL

Caspase 1 (CASP1) Mouse Monoclonal Antibody [Clone ID: OTI12A9]

Sign In for Pricing
View Details
Frozen Tissue Sections, Parotid gland
CS645953 5x 5 µm

Frozen Tissue Sections, Parotid gland

Sign In for Pricing
View Details